DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ltl and LRRC3B

DIOPT Version :10

Sequence 1:NP_729265.1 Gene:ltl / 38845 FlyBaseID:FBgn0268063 Length:817 Species:Drosophila melanogaster
Sequence 2:NP_443185.1 Gene:LRRC3B / 116135 HGNCID:28105 Length:259 Species:Homo sapiens


Alignment Length:188 Identity:45/188 - (23%)
Similarity:68/188 - (36%) Gaps:53/188 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 VNLDLDNNRIDSL-NGALAGLGNLRILNLAGNRLEHLQVGDFDGMIR-LDILDLTGNQLAELKPL 432
            |.|.||:|:|.|: |.....|..||:|||:.|.:|.:....|.|:.. |..|||:.|::.     
Human    67 VLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQ----- 126

  Fly   433 EMTLLPSLKILKVAYNNITKLEQDFKGLPVLCQANLTNNQISTISSELVTNTRCKNHNVPGKLEI 497
                    .:.|.|:||: |........|..|...|          :.|..:...||        
Human   127 --------SVHKNAFNNL-KARARIANNPWHCDCTL----------QQVLRSMASNH-------- 164

  Fly   498 HLDDNPIMCDVGLNELCRLMAVQEARIRGRSQCFENDQEVCTVLPMLYNVNLPIMVTN 555
                     :...|.:|:...:.|...|..... .||.::|         |||...|:
Human   165 ---------ETAHNVICKTSVLDEHAGRPFLNA-ANDADLC---------NLPKKTTD 203

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ltlNP_729265.1 LRR 65..476 CDD:443914 31/107 (29%)
leucine-rich repeat 65..86 CDD:275380
leucine-rich repeat 87..110 CDD:275380
leucine-rich repeat 111..134 CDD:275380
leucine-rich repeat 135..158 CDD:275380
leucine-rich repeat 159..180 CDD:275380
leucine-rich repeat 181..203 CDD:275380
leucine-rich repeat 204..226 CDD:275380
leucine-rich repeat 227..249 CDD:275380
leucine-rich repeat 250..272 CDD:275380
leucine-rich repeat 273..296 CDD:275380
leucine-rich repeat 297..315 CDD:275380
leucine-rich repeat 320..335 CDD:275378
leucine-rich repeat 344..366 CDD:275380
leucine-rich repeat 367..391 CDD:275380 9/21 (43%)
leucine-rich repeat 392..415 CDD:275380 9/22 (41%)
leucine-rich repeat 416..439 CDD:275380 5/22 (23%)
leucine-rich repeat 440..462 CDD:275380 5/21 (24%)
leucine-rich repeat 463..483 CDD:275380 3/19 (16%)