DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ltl and LRRC3C

DIOPT Version :10

Sequence 1:NP_729265.1 Gene:ltl / 38845 FlyBaseID:FBgn0268063 Length:817 Species:Drosophila melanogaster
Sequence 2:NP_001182474.1 Gene:LRRC3C / 100505591 HGNCID:40034 Length:275 Species:Homo sapiens


Alignment Length:184 Identity:45/184 - (24%)
Similarity:67/184 - (36%) Gaps:67/184 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 MAELHGLRSLKTLQLSSNRIQRLLP-DPRGVQELMLVNLDLDNNRIDSL-NGALAGLGNLRILNL 397
            :|:..|.|:.:..|...:.:...:| |.|        .|.||.|::.|: .||...|..|..|:|
Human    54 VAKEAGERTFRCSQAGLSAVPSGIPNDTR--------KLYLDANQLASVPAGAFQHLPVLEELDL 110

  Fly   398 AGNRLEHLQVGDFDGMI-RLDILDLTGNQLAELKPLEMTLLPSLKILKVAYNNITKLEQDFKGLP 461
            :.|.|.||....|.|:. .|..|||:.||||.: |:|.                      |.|| 
Human   111 SHNALAHLSGAAFQGLEGTLRHLDLSANQLASV-PVEA----------------------FVGL- 151

  Fly   462 VLCQANLTNNQISTISSELVTNTRCKNHNVPGKLEIHLDDNPIMCDVGLNELCR 515
                                            :::::|..||..||..|.|:.|
Human   152 --------------------------------QIQVNLSANPWHCDCALQEVLR 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ltlNP_729265.1 LRR 65..476 CDD:443914 37/143 (26%)
leucine-rich repeat 65..86 CDD:275380
leucine-rich repeat 87..110 CDD:275380
leucine-rich repeat 111..134 CDD:275380
leucine-rich repeat 135..158 CDD:275380
leucine-rich repeat 159..180 CDD:275380
leucine-rich repeat 181..203 CDD:275380
leucine-rich repeat 204..226 CDD:275380
leucine-rich repeat 227..249 CDD:275380
leucine-rich repeat 250..272 CDD:275380
leucine-rich repeat 273..296 CDD:275380
leucine-rich repeat 297..315 CDD:275380
leucine-rich repeat 320..335 CDD:275378 45/184 (24%)
leucine-rich repeat 344..366 CDD:275380 4/22 (18%)
leucine-rich repeat 367..391 CDD:275380 8/24 (33%)
leucine-rich repeat 392..415 CDD:275380 9/23 (39%)
leucine-rich repeat 416..439 CDD:275380 10/22 (45%)
leucine-rich repeat 440..462 CDD:275380 3/21 (14%)
leucine-rich repeat 463..483 CDD:275380 0/19 (0%)
LRRC3CNP_001182474.1 PRK15370 <43..>174 CDD:185268 45/184 (24%)
leucine-rich repeat 61..80 CDD:275378 3/18 (17%)
LRR 1 80..101 9/28 (32%)
leucine-rich repeat 81..104 CDD:275378 9/30 (30%)
LRR_8 82..140 CDD:404697 23/65 (35%)
LRR 2 104..125 8/20 (40%)
leucine-rich repeat 105..129 CDD:275378 9/23 (39%)
LRR 3 129..150 11/43 (26%)
leucine-rich repeat 130..152 CDD:275378 13/77 (17%)
leucine-rich repeat 153..164 CDD:275378 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.