DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7548 and CG8543

DIOPT Version :9

Sequence 1:NP_648131.1 Gene:CG7548 / 38843 FlyBaseID:FBgn0035792 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_648126.1 Gene:CG8543 / 38837 FlyBaseID:FBgn0035787 Length:219 Species:Drosophila melanogaster


Alignment Length:219 Identity:87/219 - (39%)
Similarity:114/219 - (52%) Gaps:29/219 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAYFQFLSVASSLLLLLAPTWAGLIAQPTITYAGNEH--AVAHTQQNVVRSFDGTVSHYAKSLAT 63
            :::...:.|||:..|..|.|:|. .:.|.:......|  ||..|||||||||.||||.|:|::.|
  Fly     8 LSFCALVGVASAGFLAPATTYAA-ASIPVVAKVAQPHYDAVGTTQQNVVRSFGGTVSTYSKNVVT 71

  Fly    64 PYSQVHKQDTRISNNVY---------QPAVAKTFSYATAPAPVYTHQAHQEP--KNLFTQASPVY 117
            |||.|.|.|:||:||||         .|.:.|:| ||.|||||.....:..|  |.::...:|||
  Fly    72 PYSSVSKVDSRITNNVYTPKTLYSAPAPVITKSF-YAAAPAPVVAKTVYSAPVAKAVYAAPAPVY 135

  Fly   118 QQDAHVQTPSVYQQAAHVQTPSVYHQPAQVQSYHQPGHVEAPSVYQQNAHYSHQP---------A 173
            ...|.|...:||....   ..:||..||.|  |..|..|.|.:||...|...|.|         |
  Fly   136 AAPAPVVAKTVYSAPV---AKAVYAAPAPV--YSAPAPVVAKTVYSAPAPVYHAPAPLVAAAPAA 195

  Fly   174 VIHYSPAETVSHMSFDGFGTHYGF 197
            .:.||||..|:|.||||||:|:|:
  Fly   196 YVKYSPAAVVAHASFDGFGSHWGY 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7548NP_648131.1 Cuticle_3 35..197 CDD:287932 78/183 (43%)
CG8543NP_648126.1 Cuticle_3 43..219 CDD:287932 78/181 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469378
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C3DU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D76018at7147
OrthoFinder 1 1.000 - - FOG0014264
OrthoInspector 1 1.000 - - mtm9613
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.