DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and AGBL4

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_011540610.1 Gene:AGBL4 / 84871 HGNCID:25892 Length:531 Species:Homo sapiens


Alignment Length:404 Identity:79/404 - (19%)
Similarity:134/404 - (33%) Gaps:168/404 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SYDGIMQYLDELALSHSNRVTLKDVARTYENRALKMAIITNGDG-RPG--KRVIFLDAALHSRE- 100
            :|.....|||.|...:.:....:.:.::.:.|.|.:..||:.|. |.|  ::|:|:...:|..| 
Human   182 TYTRFQHYLDSLQKRNMDYFFREQLGQSVQQRKLDLLTITSPDNLREGAEQKVVFITGRVHPGET 246

  Fly   101 ----------------------------WMTPAAALLTIHKLVVEFAENSD----LLTDY-DWHI 132
                                        ||:|.         :::|..:..    :|.:| .:.|
Human   247 PSSFVCQGIPPGHWAALSSSFQNSPGIHWMSPG---------IIDFLVSQHPIACVLREYLVFKI 302

  Fly   133 MPLANPDGYEYSRNTERYWRNTRTPNGGNCFGTNLNRNFAVDWNVGFPELKDPCDENYAGSSPFS 197
            .|:.||||.        |..|.|.    :..|.:|||::.           ||        ||: 
Human   303 APMLNPDGV--------YLGNYRC----SLMGFDLNRHWL-----------DP--------SPW- 335

  Fly   198 EVEARTVRDIMHGLVESKRAVM------------YLSLHTANRSVFYPWVYDTDPVSNQKEHDEI 250
                  |...:||:   |:.::            |:.:| |:.::...::|     .|..|.:| 
Human   336 ------VHPTLHGV---KQLIVQMYNDPKTSLEFYIDIH-AHSTMMNGFMY-----GNIFEDEE- 384

  Fly   251 GRFVADRIL-----QSTGTFIKTWQYAKYAGTFGGTSMDYALLAGFPLSFVFEMSGTGR------ 304
             ||....|.     |:...|           ::..||.:...:          .:||||      
Human   385 -RFQRQAIFPKLLCQNAEDF-----------SYSSTSFNRDAV----------KAGTGRRFLGGL 427

  Fly   305 -DHVEYKFFPPARDIRHLAEESW-----TGIKAFAEKTIEKYPPSRVISYNPMVKLAENAATRNL 363
             ||..|.:         ..|.|:     :|..|....|.|.|           :||..|.|...|
Human   428 LDHTSYCY---------TLEVSFYSYIISGTTAAVPYTEEAY-----------MKLGRNVARTFL 472

  Fly   364 GF---NSMVATVCL 374
            .:   |.:|..|.:
Human   473 DYYRLNPVVEKVAI 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 68/360 (19%)
AGBL4XP_011540610.1 M14_AGBL4_like 190..475 CDD:133118 74/383 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.