DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and Cpb1

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_083982.1 Gene:Cpb1 / 76703 MGIID:1923953 Length:415 Species:Mus musculus


Alignment Length:309 Identity:93/309 - (30%)
Similarity:153/309 - (49%) Gaps:21/309 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 YLSYDGIMQYLDELALSHSNRVTLKDVARTYENRALKMAIITNGDGRPGKRVIFLDAALHSREWM 102
            |.:::.|..::.::|..:.:.|:.:.:..|:|.|  .|.::..|..||.|...|:|...|:|||:
Mouse   117 YNNWETIEAWIQQVANDNPDLVSKRVIGTTFEGR--NMYVLKIGKDRPNKPAFFIDCGFHAREWI 179

  Fly   103 TPAAALLTIHKLVVEFAEN---SDLLTDYDWHIMPLANPDGYEYSRNTERYWRNTR-TPNGGNCF 163
            :||.....:.:.|..:.:.   ..||.:.|::::|:.|.|||.|:...:|.||.|| |..|.:||
Mouse   180 SPAFCQWFVREAVRTYKQEIHMKRLLDELDFYVLPVVNIDGYVYTWAKDRMWRKTRSTTAGSSCF 244

  Fly   164 GTNLNRNFAVDW-NVGFPELKDPCDENYAGSSPFSEVEARTVRDIMHGLVESKRAVMYLSLHTAN 227
            |.:.||||...| .||  ..:.||.:.|.|.:|.||.|.:.:.|.:...:.|.:|  ||::|:.:
Mouse   245 GVDPNRNFDAGWCEVG--ASRSPCSDTYCGPTPESEKETKALADFIRQNLSSIKA--YLTVHSYS 305

  Fly   228 RSVFYPWVYDTDPVSNQKEHDEIGRFVADRILQSTGTFIKTWQYAKYAGTF---GGTSMDYALLA 289
            :.:.||:.||.....|.:|.:.:.:..|..:....||   .:.|...|.|.   .|.|.|:|...
Mouse   306 QMMLYPYSYDYKLPENYEELNALVKGAAKELSTLHGT---KYTYGPGATTIYPAAGGSDDWAYDQ 367

  Fly   290 GFPLSFVFEMSGTGRDHVEYKFFPPARDIRHLAEESWTGIKAFAEKTIE 338
            |...||.||:    ||...:.|..|...||...||:...:|..|...:|
Mouse   368 GIKYSFTFEL----RDKGFFGFLLPESQIRQTCEETMLAVKYIANYVLE 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 92/304 (30%)
Cpb1NP_083982.1 Propep_M14 31..102 CDD:396700
M14_CPB 112..411 CDD:349443 92/306 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848058
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.