DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and Agbl3

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001276585.1 Gene:Agbl3 / 76223 MGIID:1923473 Length:1006 Species:Mus musculus


Alignment Length:242 Identity:53/242 - (21%)
Similarity:94/242 - (38%) Gaps:77/242 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SYDGIMQYLDELALSHSN---------RVTLKDVARTYENRALKMAIIT---NGDGRPGKRVIFL 92
            :|..:.:||..:   :|:         ||....:||   |....:.|.|   ..|.:  ::.:.|
Mouse   307 TYSNLQEYLSGI---NSDPVRSKFCKIRVLCHTLAR---NMVYVLTITTPLKTSDSK--RKAVIL 363

  Fly    93 DAALHSRE----WMTPAAALLTIHKLVVEF--AENSD--LLTD-YDWHIMPLANPDGYEYSRNTE 148
            .|.:|..|    |         |.|..:::  .::||  ||.| :.:.::|:.||||....    
Mouse   364 TARVHPGETNSSW---------IMKGFLDYILGDSSDARLLRDTFIFKVVPMLNPDGVIVG---- 415

  Fly   149 RYWRNTRTPNGGNCFGTNLNRNFAVDWNVGFPELKDPCDENYAGSSPFSEVEARTVRDIMHGLVE 213
                |.|.    :..|.:||||:.......||.:                   ...|::::.|:|
Mouse   416 ----NYRC----SLAGRDLNRNYTSLLKESFPSV-------------------WYTRNMINRLME 453

  Fly   214 SKRAVMYLSLHTANR--SVFYPWVYDTDPVSNQKEHDEIGRFVADRI 258
            .:..::|..||..:|  ::|   :|..|..|..|..   |.::..||
Mouse   454 KREVILYCDLHGHSRKQNIF---MYGCDGSSRSKTK---GLYLQQRI 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 53/242 (22%)
Agbl3NP_001276585.1 M14_AGBL2-3_like 315..576 CDD:133117 51/234 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 790..810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.