DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and agbl2

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_017209580.1 Gene:agbl2 / 568152 ZFINID:ZDB-GENE-070719-6 Length:1025 Species:Danio rerio


Alignment Length:290 Identity:61/290 - (21%)
Similarity:102/290 - (35%) Gaps:95/290 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SYDGIMQYLDELALSHSNRVT---LKDVARTYENRALKMAIITNGDG----RPGKRVIFLDAALH 97
            :|..:..||.|: :|...|..   |:.:.|:....|:.:..||....    |..||.:.:.|.:|
Zfish   337 TYSKLQHYLREV-ISDPVRAAYCKLRVLCRSLAGNAVYVLTITAPSSSLAERKAKRAVVVTARVH 400

  Fly    98 SRE----WMTPAAALLTIHKLVVEFAENSDLLTDY-DWH---------IMPLANPDGYEYSRNTE 148
            ..|    ||...         .:||     ||:|. |.|         ::|:.||||....    
Zfish   401 PGETNGSWMMQG---------FLEF-----LLSDLPDAHLLRETFIFKVIPMLNPDGVVVG---- 447

  Fly   149 RYWRNTRTPNGGNCFGTNLNRNFAVDWNVGFPELKD--PCDENYAGSSPFSEVEARTVRDIMHGL 211
                |.|.    :..|.:||||:.       ..|:|  ||              ....|:::..|
Zfish   448 ----NYRC----SLAGRDLNRNYR-------SMLRDSFPC--------------IWYTRNMVKRL 483

  Fly   212 VESKRAVMYLSLHTANR--SVFYPWVYDTDPVS------------NQKEHDEIG----RFVADRI 258
            :..:..|:|...|..:|  :||.....:....|            ::...|:..    :|...:.
Zfish   484 LAEREVVVYCDFHGHSRKNNVFMYGCNERKDASQCLQERVFPLMMSKNAKDKFSFRSCKFKMHKS 548

  Fly   259 LQSTGTFIKTWQYA---KYA--GTFGGTSM 283
            .:.||..: .|:..   .|.  .||||:::
Zfish   549 KEGTGRIV-MWRLGIRNSYTMESTFGGSTL 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 61/290 (21%)
agbl2XP_017209580.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.