DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and cpa1

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001107681.1 Gene:cpa1 / 497006 XenbaseID:XB-GENE-960032 Length:420 Species:Xenopus tropicalis


Alignment Length:348 Identity:107/348 - (30%)
Similarity:166/348 - (47%) Gaps:41/348 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLVTIVVNQL-SEAREVRRRR----GLMLQLDNYLSY---DGIMQYLDELALSHSNRVTLKDVAR 66
            :::..|.|.| .|.|::||.|    |......||.:|   |.|..::|.|...:.|.|:...:..
 Frog    88 IMIHDVQNLLDEEQRDMRRNRASEDGRSTNSFNYAAYHTFDEINAFIDNLVSENPNLVSKIQIGS 152

  Fly    67 TYENRALKMAIITNGDGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAENSDL---LTDY 128
            :||.|.|.:...:.|..||   ..::|..:|||||:|.|:|:....|:|.:|.::..|   |...
 Frog   153 SYEGRPLNVLKFSTGPNRP---AFWIDTGIHSREWVTQASAVWFAKKIVTDFGKDPSLTNTLNQM 214

  Fly   129 DWHIMPLANPDGYEYSRNTERYWRNTRTPNGGN-CFGTNLNRNFAVDWNVGF---PELKDPCDEN 189
            |..|..:.||||:.|:..::|.||.||:||.|: |.||:.|||    |:.||   ....:||.|.
 Frog   215 DILIEIVTNPDGFVYTHKSDRMWRKTRSPNSGSLCVGTDPNRN----WDAGFGGPGSSSNPCTET 275

  Fly   190 YAGSSPFSEVEARTVRDIM--HGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVSNQKEHDEIGR 252
            |.|.:..||.|.:.:.|.:  ||.::.     ::|:|:.::.:.:|:.|....|   .:|||:..
 Frog   276 YRGRAAHSEPEVKAIVDFVKSHGNIKG-----FVSIHSYSQMLLFPYGYTNTRV---PDHDELNA 332

  Fly   253 FVADRILQSTGTFIKTWQYAKYAGTF----GGTSMDYALLAGFPLSFVFEMSGTGRDHVEYKFFP 313
            .....|......:...:.|.....|.    ||| :|:....|...|:.||:..|||    |.|..
 Frog   333 VSKKAITALASLYGTAYTYGSIISTIYQASGGT-IDWTYNQGIKHSYSFELRDTGR----YGFAL 392

  Fly   314 PARDIRHLAEESWTGIKAFAEKT 336
            ||..|...|||:|..:....|.|
 Frog   393 PANQIIPTAEETWLALTILIEHT 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 95/312 (30%)
cpa1NP_001107681.1 Propep_M14 27..99 CDD:280416 3/10 (30%)
MpaA 28..402 CDD:225421 101/333 (30%)
M14_CPA 119..418 CDD:133081 98/317 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.