DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and cpb1

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_031758320.1 Gene:cpb1 / 496994 XenbaseID:XB-GENE-853710 Length:414 Species:Xenopus tropicalis


Alignment Length:336 Identity:96/336 - (28%)
Similarity:162/336 - (48%) Gaps:35/336 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IVVNQLSEAREVRRRRGL--MLQLDNYLSYDGIMQYLDELALSHSNRVTLKDVARTYENRALKMA 76
            |::|.|.:|.|.:|...:  :...:.|...|.|..:...:|..:...|:...:..:|:.|.:.:.
 Frog    90 ILINDLQDALEKQRDSNIRAVHSYEKYNDLDTINAWSANIAAQNPGLVSRSSIGTSYQGRPIYLL 154

  Fly    77 IITNGDGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEF---AENSDLLTDYDWHIMPLANP 138
            .:  |.....|:.:|:|...|:|||::||.....:.:.|..:   :|.:.||.:.|.:::|:.|.
 Frog   155 KV--GKSGANKKAVFIDCGFHAREWISPAFCQWFVKEAVSAYGVESEFTSLLDNLDIYVLPVLNV 217

  Fly   139 DGYEYSRNTERYWRNTRTPN-GGNCFGTNLNRNFAVDWNVGFPELKDPCDENYAGSSPFSEVEAR 202
            |||.|:..|.|.||.||:.| ...|.||:.||||...|.......: .|||.|.||:|.||.|.:
 Frog   218 DGYVYTWTTNRMWRKTRSANPNSTCIGTDPNRNFNAGWCTAGASTR-ACDETYCGSAPESEPETK 281

  Fly   203 TVRDIMHGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVSNQKEHDEIGRFVADRILQSTGTFIK 267
            .:.:.:...:.:.:.  ||::|:.::.:.:|:.|.   .:..|:|:|:.. ||...:.|..:..|
 Frog   282 ALANFIRANIPAIKG--YLTIHSYSQMLLFPYSYS---YAVAKDHNELNA-VAQGAVNSLTSLYK 340

  Fly   268 TWQYAKYAGTFG----------GTSMDYALLAGFPLSFVFEMSGTGRDHVEYKFFPPARDIRHLA 322
            |    ||  |:|          |.|.|:|..||...|:.||:..|||    |.|..|...|:...
 Frog   341 T----KY--TYGPGGSTIYLAAGGSDDWAYDAGVKFSYTFELRDTGR----YGFALPESQIKPTC 395

  Fly   323 EESWTGIKAFA 333
            ||:...:|..|
 Frog   396 EETMLAVKYIA 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 90/310 (29%)
cpb1XP_031758320.1 Propep_M14 31..102 CDD:396700 5/11 (45%)
M14_CPB 111..410 CDD:349443 90/315 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.