DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and cpa4

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001002217.1 Gene:cpa4 / 431764 ZFINID:ZDB-GENE-040704-61 Length:417 Species:Danio rerio


Alignment Length:344 Identity:104/344 - (30%)
Similarity:170/344 - (49%) Gaps:40/344 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TIVVNQLSEAREVRR----------RRGLMLQLDNYLSYDGIMQYLDELALSHSNRVTLKDVART 67
            |:::|.:.:..:.::          |...:.....|...|.|..::|.|..||.|.::..::..:
Zfish    85 TVMINNVQDLLDEQKAEMVSNAETERNAKIFDFAAYHDLDTIYSFMDTLVASHPNLISKINIGNS 149

  Fly    68 YENR---ALKMAIITNGDGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAEN---SDLLT 126
            ||||   |||.:  |.|:.||   .|::||.:|:|||:|.|:|:...:|:..::..:   :.||.
Zfish   150 YENRPMYALKFS--TGGENRP---AIWIDAGIHAREWVTQASAVWIANKMASDYGVDPSVTSLLG 209

  Fly   127 DYDWHIMPLANPDGYEYSRNTERYWRNTRTPN-GGNCFGTNLNRNFAVDWNVGF---PELKDPCD 187
            ..|.::|.:.|||||.::....|.||.||:.| |.:|.||:.|||    |:.||   ...|:||.
Zfish   210 QMDVYLMIVTNPDGYSFTHTDNRMWRKTRSVNPGSSCRGTDPNRN----WDAGFGGPGASKNPCS 270

  Fly   188 ENYAGSSPFSEVEARTVRDIM--HGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVSNQKEHDEI 250
            ::|.|....||||.:.|.|::  ||..:|     ::|:|:.::.:.||:.|....:.:|.|...:
Zfish   271 DSYHGPYAHSEVEVKNVVDLIKGHGNFKS-----FISIHSYSQLLMYPYGYTCTNIPDQSELHAV 330

  Fly   251 GRFVADRILQSTGTFIKTWQYAKYAGTFGGTSMDYALLAGFPLSFVFEMSGTGRDHVEYKFFPPA 315
            |......::....|..:.....|......|.|:|:....|...||.||:..||.    |.|..||
Zfish   331 GTAAIKELMSLYNTKYQVGSICKIIYQASGGSIDWTYNIGIKYSFAFELRDTGL----YGFLLPA 391

  Fly   316 RDIRHLAEESWTGIKAFAE 334
            ..|...|||:|.|:|...|
Zfish   392 NQIIPTAEETWLGLKNIME 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 101/309 (33%)
cpa4NP_001002217.1 Propep_M14 27..97 CDD:280416 2/11 (18%)
M14_CPA 115..415 CDD:133081 101/314 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593440
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.