DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and CG8562

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_648118.1 Gene:CG8562 / 38828 FlyBaseID:FBgn0035779 Length:424 Species:Drosophila melanogaster


Alignment Length:316 Identity:131/316 - (41%)
Similarity:177/316 - (56%) Gaps:18/316 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LQLDNYLSYDGIMQYLDELALSHSNRVTLKDVARTYENRALKMAIITNGDGRPGKRVIFLDAALH 97
            |..:.|.:::.|:.|:|:||....:||.:|.|..:||.|.||...||||||:..|:|||:|...|
  Fly   119 LSTERYYTHEEIINYIDDLAQRFPSRVFVKTVGWSYEQRVLKTITITNGDGKANKKVIFMDGGFH 183

  Fly    98 SREWMTPAAALLTIHKLVVEFAENSDLLTDYDWHIMPLANPDGYEYSR--NTERYWRNTRTP--- 157
            :|||::|||.|..|.:||.:|.||:.||.||||.|:||.|.||||:::  ...|.||.||.|   
  Fly   184 AREWISPAAVLYVIDQLVEQFEENAHLLKDYDWVILPLVNADGYEHTQTGTLARMWRKTRQPYTY 248

  Fly   158 NGGNCFGTNLNRNFAVDWNVGFPELKDPCDENYAGSSPFSEVEARTVRDIMHGLVESKRAVMYLS 222
            .|..|:|.:.||||...||..... .:||.:.|||.:.|||.|..||||:||.|.:  |.:|||:
  Fly   249 AGQTCYGADPNRNFDFHWNEEGAS-SNPCADTYAGPTAFSEPETITVRDLMHSLAD--RGIMYLT 310

  Fly   223 LHTANRSVFYPWVYDTDPVSNQKEHDEIGRFVADRILQSTGTFIKTWQYAKYAGTF---GGTSMD 284
            ||:....:.|||.:.:|...|.::.|.:.|..|:.|..:|||   .:.|.......   .|.|.|
  Fly   311 LHSYGNYLLYPWGWTSDLPENWEDLDAVARTGAEAIENATGT---VYTYGSSTNVLYIAAGASDD 372

  Fly   285 YALLAGFPLSFVFEMSGTGRDHVEYKFFPPARDIRHLAEESWTGIKAFAEKTIEKY 340
            |...|||.:|...|:.|.|    ...|.||...|.....|:|.||:|.|||.||.|
  Fly   373 YGYYAGFNVSITMELPGAG----SIGFNPPVTRIDEFVTETWIGIRAMAEKVIEMY 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 125/304 (41%)
CG8562NP_648118.1 Propep_M14 30..99 CDD:280416
M14_CP_A-B_like 124..420 CDD:199844 126/305 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450335
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.