DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and CG8563

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001261515.1 Gene:CG8563 / 38826 FlyBaseID:FBgn0035777 Length:440 Species:Drosophila melanogaster


Alignment Length:333 Identity:96/333 - (28%)
Similarity:157/333 - (47%) Gaps:39/333 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NQLSEAREVRRR-----RGLMLQLDNYLSYDGIMQYLDELALSHSNRVTLKDVARTYENRAL-KM 75
            ::..:|...|||     ||.   ..:|..|..::.::..||..:......:.:.|:.|.|.: .:
  Fly   123 DECEQAERPRRRTRRQARGF---FSHYPRYHEVLSFMSGLAARYPQFCRYESLGRSNEGRHIAAL 184

  Fly    76 AIITNGDGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAENSDLLTDYDWHIMPLANPDG 140
            :|..|...|| :||.::.||.|.|||:|....|...::|:......:.:|.|.:..::||.||||
  Fly   185 SISLNSRVRP-RRVAYIQAATHGREWITTQTVLYLAYELLSNLRAFTRVLQDVEIFLVPLVNPDG 248

  Fly   141 YEYSRNTERYWRNTRTPNGG-NCFGTNLNRNFAVDWNVGFPELKDPCDENYAGSSPFSEVEARTV 204
            |||:..|:|:||..|....| :|.|.::||||...||..... ::.|.|.|:|::|.||.|...|
  Fly   249 YEYTHTTDRFWRKNRHRYAGHSCSGVDINRNFGNHWNYQGAS-QNLCSEVYSGTAPNSEPETSAV 312

  Fly   205 RDIMHGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVSNQ---------KEHDEIGRFVADRILQ 260
              :.:......|..:.|.:|:..:.:|||:.|..:.|...         :..::|||:...|  .
  Fly   313 --VRYLEFNRNRVKLSLDVHSFGKFIFYPYGYAKNTVPPTVGTLRSVALRAANQIGRYRGTR--Y 373

  Fly   261 STGTFIKTWQYAKYAGTFGGTSMDYAL-LAGFPLSFVFEMSGTGRDHVEYKFFPPARDIRHLAEE 324
            :|||.......|      .|:..|:|. ..|.|||:..|:.|.       :|..||.||.|:.:|
  Fly   374 TTGTSASILYEA------SGSLDDFAYGNLGIPLSYTLELPGD-------EFHVPAHDIIHVCKE 425

  Fly   325 SWTGIKAF 332
            ::.|...|
  Fly   426 TFAGFIEF 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 90/307 (29%)
CG8563NP_001261515.1 M14_CP_A-B_like 146..437 CDD:199844 90/307 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466940
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.