DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and CG8564

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster


Alignment Length:382 Identity:110/382 - (28%)
Similarity:168/382 - (43%) Gaps:75/382 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LDNYLSYDGIMQYLDELALSHSNRVTLKDVARTYENRALKMAIIT-------------------- 79
            |..||.|..:.|||..||..:::.|.:..:..|:|.|.::...|.                    
  Fly    51 LHTYLDYKQVNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRL 115

  Fly    80 -----NGD--------GRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAENSDLLTDYDWH 131
                 ||.        |...::.:|::|..|:|||::.:.||..|::|...:..|.::|....:.
  Fly   116 FDIGPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNCIYQLTERYTRNIEVLRKLRFI 180

  Fly   132 IMPLANPDGYEYSRNTERYWRNTRTPNGGNCF-GTNLNRNFAVDWNVGFPELKDPCDENYAGSSP 195
            |:||.|||||||||.....||..|.|:....| ||:.|||:.:.||.|..::.   ...|.|.||
  Fly   181 IVPLVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFWNSGPSKIN---RNTYKGESP 242

  Fly   196 FSEVEARTVRDIMHGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVSNQKEHDEIGRFVADRILQ 260
            |||.|.|.:|.|:..:  |...:.:||||:..:|:.|||.|..|.....:|        ...:..
  Fly   243 FSEPETRAMRCILDRM--SSNLLFFLSLHSYGQSIMYPWGYCRDNPIYWRE--------LSSLAN 297

  Fly   261 STGTFIKTWQYAKY---------AGTFGGTSMDYAL-LAGFPLSFVFEMSGTGRDHVEYKFFPPA 315
            |..:.||::...:|         ..|..|:.:||.. :...|::.|.|:...     |..|.||.
  Fly   298 SGKSAIKSYNGREYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVMELPSR-----ELGFQPPV 357

  Fly   316 RDIRHLAEESWTGIKAFAEKTI--------EKYP----PSRVISYNPMVKLAENAAT 360
            ..|..:..|||.||:...:::.        ||.|    |||..|.|..|.: ||.:|
  Fly   358 EMISQIGHESWYGIREMCKRSFDLRHQIVREKEPPLPWPSRHESSNEGVAI-ENTST 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 97/340 (29%)
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 97/340 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.