DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and CG14820

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_648060.1 Gene:CG14820 / 38754 FlyBaseID:FBgn0035718 Length:416 Species:Drosophila melanogaster


Alignment Length:326 Identity:86/326 - (26%)
Similarity:150/326 - (46%) Gaps:51/326 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RRRGLMLQLDNYLSYDGIMQYLDELALSHSNRVTLKDVARTYENRALKMAIITNGDGRPGKRVIF 91
            ::|...::...:.:.:.|..:||.:...:.:.||...:..:||.|.::...|:..:|.|   .:|
  Fly   104 KQRITSMEWTQFHTLEEIYAWLDVIEDRYPDIVTPFTIGNSYEGRPIRGVKISYKEGNP---AVF 165

  Fly    92 LDAALHSREWMTPAAALLTIHKLVVEFAEN---SDLLTDYDWHIMPLANPDGYEYSRNTERYWRN 153
            :::.:|:|||:|.|.....|.:|:|  ..|   .|:..:.||:|:|:.|.||:.||...||.||.
  Fly   166 IESNIHAREWITSATITYFIDELLV--PRNPAVRDIAQNVDWYIIPVLNTDGFAYSHEVERLWRK 228

  Fly   154 TRTPNG--GNCFGTNLNRNFAVDWNVGFPELKDPCDENYAGSSPFSEVEARTVRDIMHGLVESKR 216
            :|.|:.  |.|.||:|||||...|.:...| .|||.:.|||.||.|:.|...:...::..:....
  Fly   229 SRLPSDPTGECIGTDLNRNFDYLWMLTGAE-SDPCSQLYAGPSPESDPEISQLTAYINNSIPEGT 292

  Fly   217 AVMYLSLHTANRSVFYPWVYDT-DPVSNQKEHDEIGRFVADRILQSTGTFIKTWQYAKYAGTFGG 280
            ..:|:|||:..:.|..||.:.. :...:..:...:.:..:|.:.:..||..          |:|.
  Fly   293 IKIYISLHSYGQYVLSPWGHTALEFPEHYPQMMHVAKGFSDALYRRYGTVF----------TYGS 347

  Fly   281 TSMDYALLAGFPLSFVFEMSGTG------------------RDHVEYKFFPPARDIRHLAEESWT 327
            ::           :.::|:||:|                  ||..|..|..|..||..:|.|...
  Fly   348 SA-----------TTLYEVSGSGKEWAYAVKNIKIHYTIELRDKGELGFVLPPEDIIPVAREVTE 401

  Fly   328 G 328
            |
  Fly   402 G 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 85/315 (27%)
CG14820NP_648060.1 Propep_M14 31..100 CDD:280416
M14_CP_A-B_like 115..410 CDD:199844 85/315 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466988
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.