DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and CG12374

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_610819.1 Gene:CG12374 / 36410 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster


Alignment Length:326 Identity:88/326 - (26%)
Similarity:156/326 - (47%) Gaps:39/326 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LQLDNYLSYDGIMQYLDELALSHSNRVTLKDVARTYENRALKMAIITNGDGRPGKRVIFLDAALH 97
            ::.:.|.:.|.|..::|:...:| :.:..|.:.::||.|.:|...::.   |.|.:.|||:..:|
  Fly   113 MEWETYHTLDTIYDWIDQECAAH-DFLECKVIGQSYEGRDIKSIRLSK---RSGNKAIFLEGNIH 173

  Fly    98 SREWMTPAAALLTIHKLV-VEFAENSDLLTDYDWHIMPLANPDGYEYSRNTERYWRNTRTPNG-- 159
            :.||::.|.....:::|: .|..|...|..:|||.::|:.||||:.|:...||.||..|.|||  
  Fly   174 AMEWISSATVTFLLNQLINSEDPEMQRLSEEYDWIVVPMVNPDGFVYTHEVERLWRKNRRPNGYR 238

  Fly   160 ---GNCFGTNLNRNFAVDWNVGFPELKDPCDENYAGSSPFSEVEARTVRDIM----HGLVESKRA 217
               |:|:|.::||||...|......:.:|||..:.|..|.:|||..::::.:    .|.:.|   
  Fly   239 NESGDCYGIDMNRNFDYHWGGAGWNIDEPCDHWFGGEEPNTEVEIISLQNFVSSFEDGYIRS--- 300

  Fly   218 VMYLSLHTANRSVFYPWVY-DTDPVSNQKEHDEIGRFVADRILQSTGTFIKTWQYAKYAGTFG-- 279
              |::.|...:.|..|:.: :|:...|.::...|....:|......|:   |:.|    |..|  
  Fly   301 --YMAYHAYGQYVLLPYGHSNTEFPPNYEQMKRIAAAFSDAAADVYGS---TFTY----GASGLL 356

  Fly   280 -----GTSMDYAL-LAGFPLSFVFEMSGTGRDHVEYKFFPPARDIRHLAEESWTGIKAFAEKTIE 338
                 |.:.|:|. :...|.:...|:    ||...:.||.|:..|..:..|...|:||...|..|
  Fly   357 NYVVSGAAKDWAYGVKKIPFTCTVEL----RDKGTFGFFLPSNQITEVGLEVTAGLKALVNKAAE 417

  Fly   339 K 339
            :
  Fly   418 E 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 86/315 (27%)
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416
M14_CP_A-B_like 118..415 CDD:199844 86/316 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466991
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.