DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and CG7025

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_609133.2 Gene:CG7025 / 34042 FlyBaseID:FBgn0031930 Length:429 Species:Drosophila melanogaster


Alignment Length:330 Identity:93/330 - (28%)
Similarity:156/330 - (47%) Gaps:34/330 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EAREVRRRRGLMLQLDNYLSYDGIMQYLDELALSHSNRVTLKDVARTYENRALKMAIITNGDGRP 85
            ||..::..|........|.|...|..:||::..::........|.::||.|.::...|:.....|
  Fly   106 EAANLKASRDGTFGWTKYNSLAEIYAWLDDILAAYPTITESFIVGQSYEGRTIRGIKISYKSNNP 170

  Fly    86 GKRVIFLDAALHSREWMTPAAA-------LLTIHKLVVEFAENSDLLTDYDWHIMPLANPDGYEY 143
            |   :.:::.:|:|||:|.|.|       |.:..:||.:.|||      :||:|:|:.|.||:.|
  Fly   171 G---VLIESNIHAREWITSATATWLINEFLTSTDELVRDLAEN------HDWYIVPVLNVDGFVY 226

  Fly   144 SRNTERYWRNTRTPNG-GNCFGTNLNRNFAVDWNVGFPELKDPCDENYAGSSPFSEVEARTVRDI 207
            :...:|.||.||.|:. .:|.|.:.|||:...|........:||.|:|.|..||||.|.:.:.:.
  Fly   227 THEKDRMWRKTRQPSEISSCIGADPNRNYDSHWMENEGASSNPCAEDYGGPKPFSEPEIQAMSEF 291

  Fly   208 MHGLVESKRAVMYLSLHTANRSVFYPWVYDTDPV-SNQKEHDEIGRFVADRILQST--GTFIKTW 269
            :.. ::.|..|: |:.|:.::.:..|:.:..:.. .|..:..|:.:...|.: :|.  ||   .:
  Fly   292 VIS-IKDKINVL-LAFHSYSQLLLSPYGHTKEEFPPNFDDMMEVAKAYGDAV-ESLPYGT---VY 350

  Fly   270 QYAKYAGTF---GGTSMDYAL-LAGFPLSFVFEMSGTGRDHVEYKFFPPARDIRHLAEESWTGIK 330
            :|...||..   .|.::|:|. ..|..:|:..|...|||    |.|..|...|...|||:..||.
  Fly   351 RYGSAAGILYPASGATIDWAYNEQGVEISYTIEFRDTGR----YGFILPPVHIIPNAEEALIGIA 411

  Fly   331 AFAEK 335
            |..||
  Fly   412 ALLEK 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 88/311 (28%)
CG7025NP_609133.2 Propep_M14 36..103 CDD:280416
M14_CP_A-B_like 123..416 CDD:199844 88/311 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466990
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.