DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and CG18585

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001260213.1 Gene:CG18585 / 34041 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster


Alignment Length:313 Identity:101/313 - (32%)
Similarity:158/313 - (50%) Gaps:28/313 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 YLSYDGIMQYLDELALSHSNRVTLKDVARTYENRALKMAIITNGDGRPGKRVIFLDAALHSREWM 102
            |...:.|..:|||:..::.:......|.::||.|.::...|::..|.||   ||:::.:|:|||:
  Fly   122 YYELEEIEAWLDEILNAYPSVTEEFIVGKSYEGRTIRGIKISHKAGNPG---IFIESNIHAREWI 183

  Fly   103 TPAAALLTIHKLVV-EFAENSDLLTDYDWHIMPLANPDGYEYSRNTERYWRNTRTPNGGN-CFGT 165
            |.|:|...|::|:. |.|:...|..:|||||:|:.|.||:|||...:|.||.||.|:..| |.|.
  Fly   184 TSASATWFINQLLTSEDADVRSLADNYDWHIIPVFNVDGFEYSHKKDRMWRKTRQPHATNACIGA 248

  Fly   166 NLNRNFAVDW--NVGFPELKDPCDENYAGSSPFSEVEARTVRDIMHGLVESKRAVMYLSLHTANR 228
            :.||||...|  |.|..:  :||.|.:||.:|.||.||:.:.:.:..:.:  :..:|:|.|:..:
  Fly   249 DANRNFDSYWLQNNGASD--NPCSETFAGDNPESEPEAKALVEYLTKIQD--QISVYISFHSYGQ 309

  Fly   229 SVFYPWVYDTDPV-SNQKEHDEIGRFVADRI-LQSTGTFIKTWQYAK-----YAGTFGGTSMDYA 286
            .:..|:.:..:.. .|..:...||:..||.| ....||   .:||..     |..|  |||:|:.
  Fly   310 YLLSPYGHTNEEFPENYNDILTIGKAFADAIEALPYGT---VYQYGSTADVLYVAT--GTSVDWV 369

  Fly   287 L-LAGFPLSFVFEMSGTGRDHVEYKFFPPARDIRHLAEESWTGIKAFAEKTIE 338
            . ..|..:.:..|....||    |.|..|...|....||...|:.|..|||.|
  Fly   370 FNELGKKIGYTIEYRDKGR----YGFILPPVQIIPNCEELMVGMLALIEKTKE 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 97/308 (31%)
CG18585NP_001260213.1 Propep_M14 34..105 CDD:280416
M14_CP_A-B_like 122..415 CDD:199844 97/308 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466989
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.