DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and Cpa6

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_011236694.1 Gene:Cpa6 / 329093 MGIID:3045348 Length:459 Species:Mus musculus


Alignment Length:244 Identity:72/244 - (29%)
Similarity:116/244 - (47%) Gaps:20/244 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IVVNQLSEARE-------VRRRRGLM-LQLDNYLSYDGIMQYLDELALSHSNRVTLKDVARTYEN 70
            :::..|.:|.|       .|.||.|. ...:.|.|.:.|..:|..|..:....|.:..:.|:||.
Mouse   107 VLIEDLQKAVENENSLQTQRNRRSLSEYNYEVYHSLEDIQSWLHHLNQTQPGLVRVFSIGRSYEG 171

  Fly    71 RALKMAIITNG-DGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAEN---SDLLTDYDWH 131
            |.|  .|:..| ..|..||.:::|..:|:|||:.||.....:.:.::.:..:   ..:|....::
Mouse   172 RPL--FIMQLGRKSRAYKRAVWIDCGIHAREWIGPAFCQWFVREAILTYKTDPAMKKMLNHLYFY 234

  Fly   132 IMPLANPDGYEYSRNTERYWRNTRTPNGG-NCFGTNLNRNFAVDW-NVGFPELKDPCDENYAGSS 194
            |||:.|.|||.:|...:|:||.||:.:.. .|.|.:.|||:.|.| :.|  ....|||:.|.|..
Mouse   235 IMPVFNVDGYHFSWTHDRFWRKTRSRDSKFRCRGVDANRNWKVKWCDEG--ASAHPCDDTYCGPF 297

  Fly   195 PFSEVEARTVRDIMHGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVSN 243
            |.||.|.:.|.:.:.  ...||...|||.|...:.:.||:.|....:.|
Mouse   298 PESEPEVKAVANFLR--KHRKRIRAYLSFHAYAQMLLYPYSYKYATIPN 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 65/212 (31%)
Cpa6XP_011236694.1 Propep_M14 48..119 CDD:366995 3/11 (27%)
Peptidase_M14_like 138..382 CDD:386095 65/213 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848082
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.