DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and CG8945

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster


Alignment Length:358 Identity:90/358 - (25%)
Similarity:146/358 - (40%) Gaps:102/358 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DNYLSYDGIMQYLDELALSHSNRVTLKDVARTYENRAL--------KMAIITNGDG-----RPGK 87
            :.|.::|.|::||:.:.:.|...|.|..:.|::|.|.|        :.|...|.||     ||.:
  Fly  1087 NRYHNHDEIVKYLETVRMRHPQLVELIHIGRSFEGRPLIVVKIESKQTAAAANNDGLHTIKRPKR 1151

  Fly    88 R-------VIFLDAALHSREWMTPAAALLTIHKLV-----------VEFAENSDLLTDYDWHIMP 134
            :       .:|::|......|:.||||...|.:|:           |||..|:      .|:|||
  Fly  1152 KRKSGQANAVFVEAGAQGLAWIGPAAATWMIAELLRLMKTNKSNEDVEFIRNT------TWYIMP 1210

  Fly   135 LANPDGYEYSRNTERYWRNTRT------PNG----------------GNCFGTNLNRNFAVDWNV 177
            :.|||||.||...:|:|:.:|:      |:|                ..|:|.:|:||:...|..
  Fly  1211 VLNPDGYAYSHEYDRFWKKSRSQHQTPPPSGLLDSAMTWLQQKRGPDKVCYGVDLDRNWLYHWGK 1275

  Fly   178 GFPELKDPCDENYAGSSPFSEVEARTVRDIMHGLVESKRAV-MYLSLHTANRSVFYPWVYDTDPV 241
            . ...|.||:|.|||.:||||.|.:.|.:.   |::.:..: :|:||....:.:.||  ...:..
  Fly  1276 R-GSSKAPCNEFYAGPAPFSEPETKAVSEF---LMDYRTQIKLYISLQAYGQVISYP--VKANST 1334

  Fly   242 SNQKEHDEIGRFVADRILQSTGTFIKTWQYAKY---------------AGTFGGTSMDYALLAGF 291
            .|.:..|:.    .|..:..|....|....::|               |..|.      |...|.
  Fly  1335 FNSERLDDF----LDVAMVGTDGLRKKGSKSRYKVDASNDLIEQRSGCADAFA------AYEIGI 1389

  Fly   292 PLSFVFEMSGTG-------RDHVEYKFFPPARD 317
            |.|:..:::..|       ...:|    |.|||
  Fly  1390 PFSYTLQLADNGVHGYLLPSSAIE----PTARD 1418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 90/356 (25%)
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416
M14_CP_A-B_like 1089..1430 CDD:199844 90/356 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.