DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and CG32379

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster


Alignment Length:348 Identity:117/348 - (33%)
Similarity:172/348 - (49%) Gaps:30/348 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLVTIVVNQLSEAREVRRRRGLMLQ------LDNYLSYDGIMQYLDELALSHSNRVTLKDVARTY 68
            ||:..:...:...|....|:.|::|      |..:.::..|..|||.|......||.:|....:|
  Fly    10 VLIEDLAPLVHAQRAENLRKKLLIQWPHIDVLSAFYTHSEINDYLDSLLERFPKRVQVKQFGWSY 74

  Fly    69 ENRALKMAIITNGDGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAENSDLLTDYDWHIM 133
            |.|.||:..|||||||..|.||.:|..:|:|||::|:.||..|.:|:..:.:|.:||.||||.||
  Fly    75 ERRPLKVLTITNGDGRRNKPVILIDGTVHAREWISPSMALYIIQQLLDNYGDNQELLQDYDWVIM 139

  Fly   134 PLANPDGYEYSRNTERYWRNTRTPNGG-NCFGTNLNRNFAVDWNVGFPELKDPCDENYAGSSPFS 197
            |:.|.|||||:....||||.:|.|... .|.||::||||..:|........|||:..|.|..||.
  Fly   140 PVVNADGYEYTHTDSRYWRKSRRPTSNPECIGTDINRNFGYEWGHDEGSSSDPCENIYRGERPFD 204

  Fly   198 EVEARTVRDIMHGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVSNQKEHDEIGRFVADRILQST 262
            :.|::.:||:|  |....|...|||||:.......||.|.:|.....::...:....|..|:.||
  Fly   205 QSESQVLRDVM--LHYKGRLNFYLSLHSYGNYFLLPWGYTSDFPDTYQDMMSVADAGAKAIIYST 267

  Fly   263 -GTFIKTWQYAKYAGTF------GGTSMDYAL-LAGFPLSFVFEMSGTGRDHVEYKFFPP-ARDI 318
             |.:       .|..|:      .|.:.|:|. :....::...|:...|     ::.|.| ...|
  Fly   268 NGIY-------SYGSTYYVLYPTSGDTTDFAFGVVNATVAMTMELPAAG-----FQGFDPWISQI 320

  Fly   319 RHLAEESWTGIKAFAEKTIEKYP 341
            ..|..|||.|::|.|.:.|.:||
  Fly   321 ERLVTESWVGVRAMAAEVIRRYP 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 107/306 (35%)
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 107/307 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450341
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.