DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and cpb1

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001315354.1 Gene:cpb1 / 322412 ZFINID:ZDB-GENE-030131-1132 Length:416 Species:Danio rerio


Alignment Length:357 Identity:100/357 - (28%)
Similarity:167/357 - (46%) Gaps:63/357 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VTIVVNQLSEAREVRRRRGLMLQLDN-----------YLSYDGIMQYLDELALSHSNRVTLKDVA 65
            |.::::.|.||        :..|:||           |.|:..|..:...::.::.:.::.:.:.
Zfish    88 VKVMIDNLQEA--------VKGQMDNRSPTKGHDYTKYNSWATINDWAISISSANPDLISRQSIG 144

  Fly    66 RTYENRALKMAIITNGDGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAENSD---LLTD 127
            .|||.|.:.:..|....| ..|..:|:|...|:|||:|.|.....:::.|..:..:.|   ||..
Zfish   145 NTYEGRTMHLLKIGKNTG-SNKPAVFMDCGFHAREWITHAFCQWFVNEAVSTYGSDPDMTNLLDR 208

  Fly   128 YDWHIMPLANPDGYEYSRNTERYWRNTRTPN-GGNCFGTNLNRNFAVDW-NVGFPELKDPCDENY 190
            .|:.::|:.|.|||||:.|.:|.||.||:.| |.:|.||:.||||...| .||  ...:||.:.|
Zfish   209 MDFFVLPVFNIDGYEYTWNRDRMWRKTRSKNSGSSCIGTDPNRNFNAGWCTVG--ASSNPCSDTY 271

  Fly   191 AGSSPFSEVEARTVRDIMHGLVESKRAVM--YLSLHTANRSVFYPWVYDTDPVSNQKEHDEI--- 250
            .||||.||:|::.:.:    .:.:.::|:  ||::|:.::.:.:|:.|..|..::   |.|:   
Zfish   272 CGSSPESEIESKNLAN----FIRTNKSVIKAYLTVHSYSQLLLFPYSYKYDLAAH---HSELMSV 329

  Fly   251 --GRFVADRILQSTGTFIKTWQYAKYAGTFG--------GTSMDYALLAGFPLSFVFEMSGTGRD 305
              |...|.|.|..|          ||....|        |.|.|:|...|...|:.||:    ||
Zfish   330 SQGAIAALRSLYGT----------KYTSGPGAATIYPAAGGSDDWAYDLGVKYSYTFEL----RD 380

  Fly   306 HVEYKFFPPARDIRHLAEESWTGIKAFAEKTI 337
            ...|.|..|...|:...||:...:|..|...:
Zfish   381 EGRYGFLLPESQIKPTCEETMLAVKYIANHVL 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 93/316 (29%)
cpb1NP_001315354.1 M14_CPB 112..412 CDD:199852 93/323 (29%)
Propep_M14 27..99 CDD:280416 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593423
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.