DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and Agtpbp1

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001099570.1 Gene:Agtpbp1 / 290986 RGDID:1306307 Length:1219 Species:Rattus norvegicus


Alignment Length:377 Identity:73/377 - (19%)
Similarity:121/377 - (32%) Gaps:129/377 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SYDGIMQYLDELALSHSNRVTL--KDV-ARTYENRALKMAIIT------------NGDGRPGKRV 89
            :|..:..:|.:|..:|:.:...  ||| ..|....:..:..||            ....||   .
  Rat   844 TYSTLQMHLQKLESAHNPQQIYFRKDVLCETLSGNSCPLVTITAMPESSYYEHICQFRTRP---Y 905

  Fly    90 IFLDAALHSRE----WMTPAAALLTIHKLVVEFAENSDLLTDYDWHIMPLANPDGYEYSRNTERY 150
            |||.|.:|..|    |:...    |:..|:........|...|.:.|:|:.||||          
  Rat   906 IFLSARVHPGETNASWVMKG----TLEYLMSNSPTAQSLREAYIFKIVPMLNPDG---------- 956

  Fly   151 WRNTRTPNGGN-C--FGTNLNRNFAVDWNVGFPELKDPCDENYAGSSPFSEVEARTVRDIMH--G 210
                 ..||.: |  .|.:|||    .|....|||..                     .|.|  |
  Rat   957 -----VINGNHRCSLSGEDLNR----QWQSPNPELHP---------------------TIYHAKG 991

  Fly   211 LVESKRAVMYLSL-------HTANRSVFY--------PWVYDTDPVSNQKEHDEIG--------- 251
            |::...||..|.|       |:..::||.        .| :..|..::....:::|         
  Rat   992 LLQYLAAVKRLPLVYCDYHGHSRKKNVFMYGCSIKETVW-HTHDNAASCDVVEDMGYRTLPKILS 1055

  Fly   252 -----------RFVADRILQSTGTFIKTWQYAKYAGTFGGTSMDYALLAGFPLSFVFEMSGTGRD 305
                       .||.::..:||...: .|:.                 .|...|:..|.:..|.|
  Rat  1056 HIAPAFCMSSCSFVVEKSKESTARVV-VWRE-----------------IGVQRSYTMESTLCGCD 1102

  Fly   306 HVEYKFFP-PARDIRHLAEESWTGIKAFAEKT--IEKYPPSRVISY-NPMVK 353
            ...||... ..|::..:..:...|:......|  :|...||.::.: |.:::
  Rat  1103 QGRYKGLQIGTRELEEMGAKFCVGLLRLKRLTSPLEYNLPSNLLDFENDLIE 1154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 68/354 (19%)
Agtpbp1NP_001099570.1 Pepdidase_M14_N 705..839 CDD:407865
M14_Nna1 862..1132 CDD:349477 64/335 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.