DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and AGTPBP1

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001273644.1 Gene:AGTPBP1 / 23287 HGNCID:17258 Length:1278 Species:Homo sapiens


Alignment Length:354 Identity:75/354 - (21%)
Similarity:124/354 - (35%) Gaps:83/354 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SYDGIMQYLDELALSHSNRVTL--KDV-ARTYENRALKMAIIT------------NGDGRPGKRV 89
            :|..:..:|.:|..:|:.:...  ||| ..|....:..:..||            :...||   .
Human   903 TYSTLQMHLQKLESAHNPQQIYFRKDVLCETLSGNSCPLVTITAMPESNYYEHICHFRNRP---Y 964

  Fly    90 IFLDAALHSREWMTPAAALL--TIHKLVVEFAENSDLLTDYDWHIMPLANPDGYEYSRNTERYWR 152
            :||.|.:|..|  |.|:.::  |:..|:........|...|.:.|:|:.||||            
Human   965 VFLSARVHPGE--TNASWVMKGTLEYLMSNNPTAQSLRESYIFKIVPMLNPDG------------ 1015

  Fly   153 NTRTPNGGN-C--FGTNLNRNFAVDWNVGFPELKDPCDENYAGSSPFSEVEAR--TVRDIMHGLV 212
               ..||.: |  .|.:|||    .|....|:| .|...:..|...:.....|  .|....||..
Human  1016 ---VINGNHRCSLSGEDLNR----QWQSPSPDL-HPTIYHAKGLLQYLAAVKRLPLVYCDYHGHS 1072

  Fly   213 ESKRAVMY-LSL-----HTANRSVFYPWVYDTDPVSNQKEHDEIG--------RFVADRILQSTG 263
            ..|...|| .|:     ||.:.:.....|.||...:..|....|.        .||.::..:||.
Human  1073 RKKNVFMYGCSIKETVWHTNDNATSCDVVEDTGYRTLPKILSHIAPAFCMSSCSFVVEKSKESTA 1137

  Fly   264 TFIKTWQYAKYAGTFGGTSMDYALLAGFPLSFVFEMSGTGRDHVEYKFFP-PARDIRHLAEESWT 327
            ..: .|:.                 .|...|:..|.:..|.|..:||... ..|::..:..:...
Human  1138 RVV-VWRE-----------------IGVQRSYTMESTLCGCDQGKYKGLQIGTRELEEMGAKFCV 1184

  Fly   328 GIKAFAEKT--IEKYPPSRVISY-NPMVK 353
            |:......|  :|...||.::.: |.:::
Human  1185 GLLRLKRLTSPLEYNLPSSLLDFENDLIE 1213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 70/331 (21%)
AGTPBP1NP_001273644.1 M14_Nna1 911..1188 CDD:133116 69/319 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.