DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and ccpp-6

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_495012.2 Gene:ccpp-6 / 184043 WormBaseID:WBGene00017136 Length:459 Species:Caenorhabditis elegans


Alignment Length:356 Identity:74/356 - (20%)
Similarity:128/356 - (35%) Gaps:131/356 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VARTYENRALKMAIITNGDGRP-----GKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAENSD 123
            :.:|.:.|.:.:..|   |..|     .|::|||.|.:|..|  :|::.::  |. ::||..:.|
 Worm   169 LVQTVQKRRVDLITI---DATPDTFQGSKKMIFLTARVHPGE--SPSSHVM--HG-IIEFLVSKD 225

  Fly   124 -----LLTDYDWHIMPLANPDG-----YEYS---RNTERYWRNTRTPNGGNCFGTNLNRNFAVDW 175
                 |...|.:.|:|:.||||     |..|   .:..|.|   |||:               ||
 Worm   226 DRAQKLRKVYCFKIIPMLNPDGVFLGNYRCSLMGHDLNRMW---RTPS---------------DW 272

  Fly   176 NVGFPELKDPCDENYAGSSPFSEVEARTVRDIMHGLVESKRA--VMYLSLHTANRSVFYPWVYDT 238
              ..|.:       ||            |::::.....:.:|  |:|:.||              
 Worm   273 --AHPSI-------YA------------VKNLLTQYDNNPQAQTVIYVDLH-------------- 302

  Fly   239 DPVSNQKEHDEIGRFVADRILQSTGTFIKTW--------------QYAKY------AGTFGGTSM 283
              ..:||.:..:...|....::...||.:.|              ::.::      |||...|..
 Worm   303 --AHSQKPNCFLYGNVNMSAVEEKSTFRQLWLPHLLADLSEDYSLEFTQFNTDVEKAGTGRRTMG 365

  Fly   284 DYALLAGFPLSFVF------EMSGTGRDH----VEYK--------------FFPPARDIRHLAEE 324
            |......:.|...|      :.||.|..|    ::||              |:.....:|.:..|
 Worm   366 DLLSCLCYTLEVSFFSYRHTDSSGNGIQHCTPYLQYKYEALGEAFCRALLNFYEADCGLREIVLE 430

  Fly   325 S--WTGIKAFAEKTIEKYPPSRVISYNPMVK 353
            .  .|.:.|.|:||::|  .:|.:....|:|
 Worm   431 RPFKTFLPARAQKTLKK--QARKVIQTVMMK 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 68/336 (20%)
ccpp-6NP_495012.2 M14_AGBL4_like 153..418 CDD:133118 62/311 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.