DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and ccpp-1

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_491674.2 Gene:ccpp-1 / 172241 WormBaseID:WBGene00018995 Length:1015 Species:Caenorhabditis elegans


Alignment Length:191 Identity:42/191 - (21%)
Similarity:69/191 - (36%) Gaps:50/191 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VARTYENRALKMAIITNGDGR---PGKRVIFLDAALHSRE----WMTPAAALLTIHKLVVEFAEN 121
            :..:.....:||..||.....   ..:.||.|.|.:|..|    |:...   :..:.|..:..|.
 Worm   756 IGHSLAGNPIKMLTITTPASAAEIAAREVIVLSARVHPGETNASWIMQG---ILENLLCRQSNEM 817

  Fly   122 SDLLTDYDWHIMPLANPDGYEYSRNTERYWRNTRTPNGGN-C--FGTNLNRNFAVDWNVGFPE-- 181
            ..|...:.:.|:|:.||||               ..||.: |  .|.:|||.:........||  
 Worm   818 YRLRESFIFKIVPMINPDG---------------VTNGSHRCSLAGIDLNRMWDRPNEALHPEVF 867

  Fly   182 -----LKDPCDENYAGSSPFSEVEARTVRDIMHGLVESKRAVMYLSLHTANRSVFYPWVYD 237
                 ::..|:  .|...||:.|:       :||  .||:...::..:.|:.|    |..|
 Worm   868 ATKAIIQYLCE--VANKKPFAYVD-------IHG--HSKKWDYFVYGNNASES----WRAD 913

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 42/191 (22%)
ccpp-1NP_491674.2 M14_Nna1_like_2 738..1011 CDD:199859 42/191 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.