DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and CPO

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_775100.1 Gene:CPO / 130749 HGNCID:21011 Length:374 Species:Homo sapiens


Alignment Length:319 Identity:93/319 - (29%)
Similarity:162/319 - (50%) Gaps:25/319 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LDNYLSYD------GIMQYLDELALSHSNRVTLKDVARTYENRALKMAIITNGDGRPGKRVIFLD 93
            |:.| ||:      .|.:::.|::..:...||...:..|||...:....|:...|.| |::|::|
Human    42 LETY-SYNIYHPMGEIYEWMREISEKYKEVVTQHFLGVTYETHPMYYLKISQPSGNP-KKIIWMD 104

  Fly    94 AALHSREWMTPAAALLTIHKLVVEFAENSD---LLTDYDWHIMPLANPDGYEYSRNTERYWRNTR 155
            ..:|:|||:.||.....:.:::....:||.   ||.:.|::::|:.|.|||.|:..|:|.||.:|
Human   105 CGIHAREWIAPAFCQWFVKEILQNHKDNSSIRKLLRNLDFYVLPVLNIDGYIYTWTTDRLWRKSR 169

  Fly   156 TP-NGGNCFGTNLNRNFAVDW-NVGFPELKDPCDENYAGSSPFSEVEARTVRDIMHGLVESKR-- 216
            :| |.|.||||:|||||...| ::|  ..::..|:.:.|:.|.||.|.:.|.    ..:|||:  
Human   170 SPHNNGTCFGTDLNRNFNASWCSIG--ASRNCQDQTFCGTGPVSEPETKAVA----SFIESKKDD 228

  Fly   217 AVMYLSLHTANRSVFYPWVYDTDPVSNQKEHDEIGRFVADRILQSTGTFIKTWQYAKYAGTFGGT 281
            .:.:|::|:..:.:..|:.|..:..||..|..::|:..|:.:....||..:....|.......|:
Human   229 ILCFLTMHSYGQLILTPYGYTKNKSSNHPEMIQVGQKAANALKAKYGTNYRVGSSADILYASSGS 293

  Fly   282 SMDYALLAGFPLSFVFEMSGTGRDHVEYKFFPPARDIRHLAEESWTGIKAFAEKTIEKY 340
            |.|:|...|.|.|:.||:    ||...|.|..|...|:...||:...:.:..:....|:
Human   294 SRDWARDIGIPFSYTFEL----RDSGTYGFVLPEAQIQPTCEETMEAVLSVLDDVYAKH 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 91/309 (29%)
CPONP_775100.1 M14_CPO 47..344 CDD:133105 89/307 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157684
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.