DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and Cpa3

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_031779.1 Gene:Cpa3 / 12873 MGIID:88479 Length:417 Species:Mus musculus


Alignment Length:340 Identity:89/340 - (26%)
Similarity:159/340 - (46%) Gaps:39/340 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IVVNQLSEAREVRRRRGLMLQLD------------NYLSYDGIMQYLDELALSHSNRVTLKDVAR 66
            |:::.|.|  |:.:      |.|            .|..:|.|:.:.:::...|...|:...:..
Mouse    91 ILIHDLQE--EIEK------QFDVKDEIAGRHSYAKYNDWDKIVSWTEKMLEKHPEMVSRIKIGS 147

  Fly    67 TYENRALKMAIITNGDGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAEN---SDLLTDY 128
            |.|:..|.:..|...||.  ::.||:|..:|:|||::||.....:::....:.:|   :.||...
Mouse   148 TVEDNPLYVLKIGKKDGE--RKAIFMDCGIHAREWISPAFCQWFVYQATKSYGKNKIMTKLLDRM 210

  Fly   129 DWHIMPLANPDGYEYSRNTERYWRNTRTPN-GGNCFGTNLNRNFAVDWNVGFPELKDPCDENYAG 192
            :::::|:.|.|||.:|...:|.||..|:.| ...|.||:|||||.|.|: ..|....||...|.|
Mouse   211 NFYVLPVFNVDGYIWSWTQDRMWRKNRSRNQNSTCIGTDLNRNFDVSWD-SSPNTNKPCLNVYRG 274

  Fly   193 SSPFSEVEARTVRDIMHGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVSNQKEHDEIGRFVADR 257
            .:|.||.|.:.|.:.:...:.|.:|  |::.|:.::.:..|:.|......|.::..::.|...|.
Mouse   275 PAPESEKETKAVTNFIRSHLNSIKA--YITFHSYSQMLLIPYGYTFKLPPNHQDLLKVARIATDA 337

  Fly   258 ILQSTGTFIKTWQYAKYAGTF---GGTSMDYALLAGFPLSFVFEMSGTGRDHVEYKFFPPARDIR 319
            :  || .:...:.|...|.|.   .|:|:|:....|...:|.||:    ||..:..|..|...|:
Mouse   338 L--ST-RYETRYIYGPIASTIYKTSGSSLDWVYDLGIKHTFAFEL----RDKGKSGFLLPESRIK 395

  Fly   320 HLAEESWTGIKAFAE 334
            ...:|:...:|..|:
Mouse   396 PTCKETMLSVKFIAK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 83/304 (27%)
Cpa3NP_031779.1 Propep_M14 28..102 CDD:280416 4/12 (33%)
Peptidase_M14_like 114..413 CDD:299699 83/309 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848044
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.