DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and cpa3

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_031758725.1 Gene:cpa3 / 100494117 XenbaseID:XB-GENE-853724 Length:418 Species:Xenopus tropicalis


Alignment Length:346 Identity:94/346 - (27%)
Similarity:172/346 - (49%) Gaps:32/346 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VTIVVNQLSEAREV---RRRRGLMLQLDN-----------YLSYDGIMQYLDELALSHSNRVTLK 62
            |.|::.|.|...||   ..:.|:..||:|           |.:::.|:::..:|...:.|.|...
 Frog    83 VQILLQQNSVPYEVLFHDLQEGIEAQLNNTKKSKRHSYTKYNTWEKIVEWTSKLTKKYPNLVQRI 147

  Fly    63 DVARTYENRALKMAIITNGDGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAENSDLLTD 127
            |:.::.|.|.:.:..:.|.|.  ..:.||:|..:|:|||::||.....:.:|:.......:|:..
 Frog   148 DIGKSVEGRPMYVLQVGNPDS--ATKAIFMDCGIHAREWISPAFCQWFVKELIKGKNNIRELVKS 210

  Fly   128 YDWHIMPLANPDGYEYSRNTERYWRNTRTPN-GGNCFGTNLNRNFAVDW-NVGFPELKDPCDENY 190
            ..::|:|:.|.|||.::...:|.||..|:|: ...|.||:|||||.:.| ::|..:  :||.|.|
 Frog   211 LTFYILPVFNIDGYVWTWTEDRMWRKNRSPSEDAKCVGTDLNRNFNISWCDIGSSD--EPCSEIY 273

  Fly   191 AGSSPFSEVEARTVRDIMHGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVSNQKEHDEIGRFVA 255
            .|::..||:|.:.|...:...|:|.:|  |:|.|:.::.:.:|:.|..:...:.||.|||.:   
 Frog   274 CGAAAESEIETKNVASFIRSHVDSIKA--YISFHSFSQMLLFPFSYTYELAPDHKELDEIAK--- 333

  Fly   256 DRILQSTGTFIKTWQYAKYAGTF---GGTSMDYALLAGFPLSFVFEMSGTGRDHVEYKFFPPARD 317
            ..:.:..|.:..::.|...|.|.   .|:|.|:|...|...||.||:    ||..:..|..|...
 Frog   334 GAVAELQGLYGTSYTYGPSASTIYPTAGSSDDWAYSLGIKYSFTFEL----RDEGKKGFLLPQSQ 394

  Fly   318 IRHLAEESWTGIKAFAEKTIE 338
            |:...:|:...:...|:..::
 Frog   395 IKATCQETTLAVAYIAKYVLD 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 84/301 (28%)
cpa3XP_031758725.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.