DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and LOC100490370

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_031749426.1 Gene:LOC100490370 / 100490370 -ID:- Length:491 Species:Xenopus tropicalis


Alignment Length:356 Identity:106/356 - (29%)
Similarity:174/356 - (48%) Gaps:38/356 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NYLSY---DGIMQYLDELALSHSNRVTLKDVARTYENRALKMAIITNGDGRPG---KRVIFLDAA 95
            ||.:|   :.|..:::.:|..||..||...:..|||:|.::...|:    :|.   |:::::|..
 Frog   158 NYTTYHPMNEIYDWINGIAKKHSQFVTQHLLGLTYESRPMQYLKIS----QPSENHKKIVWIDCG 218

  Fly    96 LHSREWMTPAAALLTIHKLVVEFAENSD----LLTDYDWHIMPLANPDGYEYSRNTERYWRNTRT 156
            :|:|||:.||.....:.:.:|:..:|..    :|.:.|.:::|:.|.|||.||...||.||..|:
 Frog   219 IHAREWIAPAFCQWFVKEQIVQNYQNDQRIRKILQNLDIYVLPVLNIDGYIYSWTKERLWRKNRS 283

  Fly   157 PNG-GNCFGTNLNRNFAVDWNVGFPELKDPCDEN-YAGSSPFSEVEARTVRDIMHGLVESKRA-- 217
            ..| |.|:|.:|||||.|.|..  ......|..| :.||||.||.|.|.|.:    .|||::|  
 Frog   284 QYGNGTCYGVDLNRNFNVSWCT--HRSSTNCSSNSFCGSSPVSEPETRAVVE----FVESRKADI 342

  Fly   218 VMYLSLHTANRSVFYPWVYDTDPVSNQKEHDEIGRFVADRILQSTGTFIKTWQYAKYAGTFGGTS 282
            |.:|::|:.::.:...:.|.|....|..|..::....|..:.:..||..:...::|......|||
 Frog   343 VCFLTMHSYSQLILTAYGYSTGLSRNYNEIFKVAEMAASAMEKIHGTKYRAGPFSKLLYEASGTS 407

  Fly   283 MDYALLAGFPLSFVFEMSGTGRDHVEYKFFPPARDIRHLAEESWTGIKAFAEKTIEKYPPSRVIS 347
            .|:....|...||.||:    ||:..:||..|...|:...||:..|:....|...|||.|::..:
 Frog   408 QDWVHDLGIDFSFTFEL----RDNGSHKFTLPEDQIQPTCEETMAGVMTIIEYVNEKYFPNKAST 468

  Fly   348 --YNPMVKLAENAATRNLGFNSMVATVCLFF 376
              :|..:.:        |.||:.:....|||
 Frog   469 TVFNCWINI--------LIFNTFMQVSVLFF 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 93/310 (30%)
LOC100490370XP_031749426.1 Propep_M14 73..>123 CDD:396700
Peptidase_M14_like 159..457 CDD:416253 94/311 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.