DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and cpo.1

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_031748368.1 Gene:cpo.1 / 100145253 XenbaseID:XB-GENE-989447 Length:451 Species:Xenopus tropicalis


Alignment Length:333 Identity:96/333 - (28%)
Similarity:168/333 - (50%) Gaps:26/333 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SEAREVRRRRGLMLQLDNYLSY---DGIMQYLDELALSHSNRVTLKDVARTYENRALKMAIITNG 81
            |...:.||::.::.:.| |.:|   |.|.|::|::..::|:.|::..:..|||.|.:....|   
 Frog   107 SNVGDYRRQKKILAEFD-YTTYHPMDEIYQWMDQVKEAYSDLVSMHYLGSTYELRPIYYFKI--- 167

  Fly    82 DGRPG---KRVIFLDAALHSREWMTPAAALLTIHKLVVEFAEN---SDLLTDYDWHIMPLANPDG 140
             |.|.   |::|::|..:|:|||:..|.....:.:::.....|   ..:|.:.|::|:|:.|.||
 Frog   168 -GWPSDKQKKIIWMDCGIHAREWIAVAYCQWFVKEILETHKTNPLLQKVLHNIDFYIVPVLNIDG 231

  Fly   141 YEYSRNTERYWRNTRTP-NGGNCFGTNLNRNFAVDW-NVGFPELKDPC-DENYAGSSPFSEVEAR 202
            :.||.|..|.||.:|:| |.|:|:|.:|||||...| ::|   ..:.| ||.|.|:.|.||.|..
 Frog   232 FVYSWNVNRLWRKSRSPHNNGSCYGVDLNRNFNSKWGSIG---ASNNCRDETYCGTGPASEPEVN 293

  Fly   203 TVRDIMHGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVSNQKEHDEIGRFVADRILQSTGTFIK 267
            .|..::..|  ....:.:|::|:..:.:..|:.|..||..|.:|...:.:..|.::.:..||..:
 Frog   294 AVSKLLGSL--KSDVLCFLTIHSYGQLLLLPYGYTKDPSINHEEMINVAQKAAAKLQEKHGTEYR 356

  Fly   268 TWQYAKYAGTFGGTSMDYALLAGFPLSFVFEMSGTGRDHVEYKFFPPARDIRHLAEESWTGIKAF 332
            ....:....:..|:|.|:|...|...|:.||:..||    .:.|..||..||...||:..|:...
 Frog   357 VGSTSHLLYSNSGSSRDWATDLGINFSYTFELRDTG----AHGFILPANQIRPTCEETMAGVMTI 417

  Fly   333 AEKTIEKY 340
            .|....|:
 Frog   418 VEHVDAKF 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 90/308 (29%)
cpo.1XP_031748368.1 Propep_M14 36..105 CDD:396700
M14_CPO 124..421 CDD:349466 91/309 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.