DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and cpa6

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001120005.1 Gene:cpa6 / 100144967 XenbaseID:XB-GENE-960985 Length:433 Species:Xenopus tropicalis


Alignment Length:359 Identity:101/359 - (28%)
Similarity:166/359 - (46%) Gaps:62/359 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IVVNQLS---EAREV----RRRRGLMLQLDNYLSY------DGIMQYLDELALSHSNRVTLKDVA 65
            |:||.:.   ||::|    |:||.|...  ||..|      :..|.|:::   :|.:.|:|..:.
 Frog   102 ILVNNVQTMLEAQQVSRPRRKRRSLSKY--NYNEYHPLHEIESWMFYMNK---THPDLVSLFSIG 161

  Fly    66 RTYENRA---LKMAIITNGDGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAENSD---- 123
            ::||.|:   ||:...||.    .|:.:::|..:|:|||:.||.....:.:.:..:  |:|    
 Frog   162 KSYEGRSLFVLKLGKRTNS----YKKAVWIDCGMHAREWIGPAFCQWFVKEAINTY--NTDPAMK 220

  Fly   124 ----LLTDYDWHIMPLANPDGYEYSRNTERYWRNTRTPNGG-NCFGTNLNRNFAVDWNVGFPELK 183
                ||..|   :||:.|.|||.:|.||:|:||.||:.|.. .|:|.:.|||:.|.|:.....| 
 Frog   221 KILNLLYIY---VMPVFNVDGYHFSWNTDRFWRKTRSKNTRYQCYGVDANRNWKVHWSDEGASL- 281

  Fly   184 DPCDENYAGSSPFSEVEARTVRDIMHGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVSN----- 243
            :|||..|.|..|.||.|.:.|...::  .:.|....|:|.|...:.:.||:.|....:.|     
 Frog   282 NPCDNTYCGPFPESEPEVKAVAQFLY--KQRKHVRAYMSFHAYAQMLLYPYSYQYGAIPNFGCVE 344

  Fly   244 QKEHDEIGRFVADRILQSTGTFIKTWQYAKYAGTF---GGTSMDYALLAGFPLSFVFEMSGTGRD 305
            ...|        :.:|.....:...:::...:.|.   .|:|||:|...|.|.|:.||:..||  
 Frog   345 SAAH--------NAVLAIRSAYGIRYRHGPASSTLYLTSGSSMDWAYNNGIPYSYAFELRDTG-- 399

  Fly   306 HVEYKFFPPARDIRHLAEESWTGIKAFAEKTIEK 339
              .|.|..|...|:....|:...:|......::|
 Frog   400 --YYGFLLPEGLIKPTCVETMLAVKNITIHALKK 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 89/322 (28%)
cpa6NP_001120005.1 Propep_M14 39..113 CDD:280416 3/10 (30%)
Peptidase_M14_like 133..432 CDD:299699 89/326 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.