DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and cpo

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001139101.1 Gene:cpo / 100005630 ZFINID:ZDB-GENE-070619-6 Length:363 Species:Danio rerio


Alignment Length:335 Identity:95/335 - (28%)
Similarity:157/335 - (46%) Gaps:27/335 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LCGIVVLVTIVVNQLSEAREVRRRRGLMLQLDNYLSY---DGIMQYLDELALSHSNRVTLKDVAR 66
            :..|:|::|:|...       |...||..:..:|..|   |.|..:::::...:.:.|:.....:
Zfish     6 ITSILVVLTLVAQD-------RLAGGLEHKSYDYTKYHTMDEISAWMNQMQRENPDVVSTMTYGQ 63

  Fly    67 TYENRALKMAIITNGDGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAENSD---LLTDY 128
            |||.|.:.:..|......| |:.|::|..:|:|||:.||.....:.:::..:..:|.   |..:.
Zfish    64 TYEKRNITLLKIGFSSTTP-KKAIWMDCGIHAREWIAPAFCQHFVKEVLGSYKTDSRVNMLFKNL 127

  Fly   129 DWHIMPLANPDGYEYS--RNTERYWRNTRTP--NGGNCFGTNLNRNFAVDWN-VGFPELKDPCDE 188
            |::|.|:.|.|||.||  .|:.|.||.:|:|  ....|.||:|||||..:|. ||..  ::.|.|
Zfish   128 DFYITPVLNMDGYIYSWLNNSTRLWRKSRSPCHENSTCSGTDLNRNFYANWGMVGIS--RNCCSE 190

  Fly   189 NYAGSSPFSEVEARTVRDIMHGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVSNQKEHDEIGRF 253
            .|.|::..||.||..|.|.:.  ......:.||::|:..:.:..|:.:......|..|..|:|..
Zfish   191 VYNGATALSEPEAEAVTDFLG--AHQNHLLCYLTIHSYGQLILVPYGHPNISAPNYDELMEVGLA 253

  Fly   254 VADRILQSTGTFIKTWQYAKYAGTFGGTSMDYALLAGFPLSFVFEMSGTGRDHVEYKFFPPARDI 318
            .|..|....|...|............|:|.|:|.|.|.|.||.||:    ||..::.|..|...|
Zfish   254 AAKAIKAVHGKSYKVGSSPDVLYPNSGSSRDFARLIGIPYSFTFEL----RDEGQHGFILPEDQI 314

  Fly   319 RHLAEESWTG 328
            :...:|::.|
Zfish   315 QPTCQEAYEG 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 88/302 (29%)
cpoNP_001139101.1 M14_CP_A-B_like 35..332 CDD:199844 87/299 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593452
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.