DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8539 and cpb2

DIOPT Version :9

Sequence 1:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001018539.2 Gene:cpb2 / 100000935 ZFINID:ZDB-GENE-050522-259 Length:424 Species:Danio rerio


Alignment Length:312 Identity:84/312 - (26%)
Similarity:151/312 - (48%) Gaps:19/312 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DNYLSYDGIMQYLDELALSHSNRVTLKDVARTYENRALKMAIITNGDGRPGKRVIFLDAALHSRE 100
            :.|.|.:.|..::::.:..||:.|.:..:..:.|.|.|.:..::........|.:::|..:|:||
Zfish   122 ERYHSLEDIYYWINKTSREHSDMVKVILIGSSSEKRPLYVLKLSGKREEEVNRAMWMDCGIHARE 186

  Fly   101 WMTPAAALLTIHKLVVEFAEN---SDLLTDYDWHIMPLANPDGYEYSRNTERYWRNTRTPNGGN- 161
            |:.||..:..::..:..:.:|   :::|...|.:|:.:.|||||:|:..|:|.||..|:.|..: 
Zfish   187 WIAPAFCMWFVNYALAFYNQNTEITEMLNKMDIYILTVMNPDGYKYTWTTDRMWRKNRSENKDSY 251

  Fly   162 CFGTNLNRNFAVDW-NVGFPELKDPCDENYAGSSPFSEVEARTVRDIMHGLVESKRAVMYLSLHT 225
            |.|.:|||||..:| ..|..:  ||||..|.|..|.||.|.:.|...:....::.:  :|||:|:
Zfish   252 CAGVDLNRNFDANWCTKGASD--DPCDPTYCGQFPESEPETQAVAKFLRSHKDTVK--LYLSIHS 312

  Fly   226 ANRSVFYPWVYDTDPVSNQKEHDEIGRFVADRILQSTGTFIKTWQYAKYAGTF---GGTSMDYAL 287
            .::.:.:|:....:.:.|   |:|:...|.:...:....:...::|...|.|.   .|.|.|:|.
Zfish   313 YSQMLLFPYSCSYNEIPN---HNELFELVKEASTKIRRYYRNNYKYGSGAKTIYLAPGGSDDWAY 374

  Fly   288 LAGFPLSFVFEMSGTGRDHVEYKFFPPARDIRHLAEESWTGIKAFAEKTIEK 339
            ..|...||.||:    :|..:|.|..|...|.....|:....|..|...|.|
Zfish   375 DLGIKYSFTFEL----QDRGQYGFLLPPSFIPQACNEALLAAKVIALHVINK 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 82/304 (27%)
cpb2NP_001018539.2 Propep_M14 32..98 CDD:280416
M14_CPB2 120..420 CDD:199868 82/308 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593457
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.