DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d8 and DIT2

DIOPT Version :9

Sequence 1:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_010690.1 Gene:DIT2 / 852011 SGDID:S000002810 Length:489 Species:Saccharomyces cerevisiae


Alignment Length:484 Identity:105/484 - (21%)
Similarity:197/484 - (40%) Gaps:113/484 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 REYVLKFGHLQRVWIFNRLLIMSGDAELNEQLLSSQEHLVKH------PVYKVLGQWLGNGLLLS 117
            ||.:.|:|.: :.:..:|..|:...:|...|:...::...|.      | |..|..:.|:.::.:
Yeast    60 RESMEKYGAV-KFFFGSRWNILVSRSEYLAQIFKDEDTFAKSGNQKKIP-YSALAAYTGDNVISA 122

  Fly   118 DGKVWHQRRKIIT---------PTF-HFSILEQFVE--VFDQQSNICVQRLAQKANGNTFDVYRS 170
            .|.||...|..:|         |.| :..||...::  :.:.|::|.:..|:|:           
Yeast   123 YGAVWRNYRNAVTNGLQHFDDAPIFKNAKILCTLIKNRLLEGQTSIPMGPLSQR----------- 176

  Fly   171 ICAAALDIIAETAMGTKIYAQANESTPYAEAVNECTALLSWRFMSVYLQVELLFTLTHPHLKWRQ 235
               .|||.|::.|:|....|..:|...:.|           ..:.:..|:...|.||.|.|    
Yeast   177 ---MALDNISQVALGFDFGALTHEKNAFHE-----------HLIRIKKQIFHPFFLTFPFL---- 223

  Fly   236 TQLIRTMQEFTIKVIEKRRQALED----QQSKLMDTADEDVGS----KRRMALLDVLLM---STV 289
                      .:..|..|::|.:|    ::..:....||.|.:    :...|..|::..   ..:
Yeast   224 ----------DVLPIPSRKKAFKDVVSFRELLVKRVQDELVNNYKFEQTTFAASDLIRAHNNEII 278

  Fly   290 DGRPLTNDEIREEVDTFMFEGHDTTTSALSFCLHELSRHP-EVQAKMLEEIVQVLGTDRSRPVSI 353
            |.:.||     :.:...:..||:......:..|:.|:::. |.|.|:.:|:..:  ||.      
Yeast   279 DYKQLT-----DNIVIILVAGHENPQLLFNSSLYLLAKYSNEWQEKLRKEVNGI--TDP------ 330

  Fly   354 RDLGELKYMECVIKESLRMYPPVPIVGRKLQTDFKYTHSVHGDGVIPAGSEIIIGIFGVHRQPET 418
            :.|.:|..:...:.|.:|||||:..:..:..|.   |..:..:.|||.|..:....||....|:|
Yeast   331 KGLADLPLLNAFLFEVVRMYPPLSTIINRCTTK---TCKLGAEIVIPKGVYVGYNNFGTSHDPKT 392

  Fly   419 F-PNPDEFIPERHENGSRVAPFK-----------MIPFSAGPRNCIGQKFAQLEMKMMLAKIVRE 471
            : ...|:|.|||.  ||.:...:           :..|..|.|.|:|:|.|..||::.||:::::
Yeast   393 WGTTADDFKPERW--GSDIETIRKNWRMAKNRCAVTGFHGGRRACLGEKLALTEMRISLAEMLKQ 455

  Fly   472 Y----------ELLPMGQRVECIVNIVLR 490
            :          :|.|.|..  |.:|:.|:
Yeast   456 FRWSLDPEWEEKLTPAGPL--CPLNLKLK 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 102/477 (21%)
DIT2NP_010690.1 CYP56-like 65..485 CDD:410693 103/479 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.