DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d8 and CYP702A1

DIOPT Version :9

Sequence 1:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_176744.1 Gene:CYP702A1 / 842878 AraportID:AT1G65670 Length:482 Species:Arabidopsis thaliana


Alignment Length:524 Identity:124/524 - (23%)
Similarity:221/524 - (42%) Gaps:91/524 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLFLLVVLLFGAGWIIHLGQADRRRKVANLPGPICPPLIG----------AMQLMLRLNPKTFI 55
            :::.|:||.||  .||..........|:.  ||.:..|:||          |.|.      .|||
plant    10 VMVSLIVVKLF--HWIYQSKNPKPNEKLP--PGSMGFPIIGETFEFMKPHDAFQF------PTFI 64

  Fly    56 KVGREYVLKFGHLQRVWIFNRLLIMSGDAELNEQLLSSQEHLVKHP--VYKVLGQWLGNGLLLSD 118
            |   |.::::|.:.|..:|...:|:|.|.|||.::..:     .|.  :.|.:.|..|...|...
plant    65 K---ERIIRYGPIFRTSLFGAKVIISTDIELNMEIAKT-----NHAPGLTKSIAQLFGENNLFFQ 121

  Fly   119 GKVWHQRRKIITPTFHFSIL-EQFVEVFDQQSNICVQR--LAQKANGNTFDVYRSICAAALDIIA 180
            .|..|:..:.:|    |.:| .|.:::...|....:.|  :.:.|.....||........::.:|
plant   122 SKESHKHVRNLT----FQLLGSQGLKLSVMQDIDLLTRTHMEEGARRGCLDVKEISSKILIECLA 182

  Fly   181 ETAMGTKIYAQANESTPYAEAVNECTALLSWR-FMSVYLQ--VELLFTLTHPHLKWRQTQLIRTM 242
            :...|        :..|  ||..|..  |.|| |.|.:.:  :.|..|..:..:|.|: :::..:
plant   183 KKVTG--------DMEP--EAAKELA--LCWRCFPSGWFRFPLNLPGTGVYKMMKARK-RMLHLL 234

  Fly   243 QEFTIKVIEKRRQALEDQQSKLMDTADEDVGSKRRMALLDVLLMSTVDGRPLTNDEIREEVDTFM 307
            :|   .:::||             .:.|::|...::.......||.        |...|.:.|..
plant   235 KE---TILKKR-------------ASGEELGEFFKIIFEGAETMSV--------DNAIEYIYTLF 275

  Fly   308 FEGHDTTTSALSFCLHELSRHPEVQAKMLEEIVQVL--GTDRSRPVSIRDLGELKYMECVIKESL 370
            ...::||...|:..:..:|.:|:|..::..|...::  .|::...::..:...:.:.:.||.|||
plant   276 LLANETTPRILAATIKLISDNPKVMKELHREHEGIVRGKTEKETSITWEEYKSMTFTQMVINESL 340

  Fly   371 RMYPPVPIVGRKLQTDFKYTHSVHGDGVIPAGSEIIIGIFGVHRQPETFPNPDEFIPERHEN--- 432
            |:....|.|.|....:|:.     |...|||| .|.:|....|..|:|:.:|..|.|.|.|.   
plant   341 RITSTAPTVFRIFDHEFQV-----GSYKIPAG-WIFMGYPNNHFNPKTYDDPLVFNPWRWEGKDL 399

  Fly   433 GSRVAPFKMIPFSAGPRNCIGQKFAQLEMKMMLAKIVREYELLPMGQRVECIVNIVLRSETGFQL 497
            |:.|:. ..|||.||.|.|:|.:||:|:|.:.:..:.|:...:.:|..:  :.|.||....|.::
plant   400 GAIVSR-TYIPFGAGSRQCVGAEFAKLQMAIFIHHLSRDRWSMKIGTTI--LRNFVLMFPNGCEV 461

  Fly   498 GMRK 501
            ...|
plant   462 QFLK 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 103/443 (23%)
CYP702A1NP_176744.1 p450 8..440 CDD:386267 118/495 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.