DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d8 and CYP96A8

DIOPT Version :9

Sequence 1:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_175193.1 Gene:CYP96A8 / 841171 AraportID:AT1G47620 Length:520 Species:Arabidopsis thaliana


Alignment Length:521 Identity:118/521 - (22%)
Similarity:228/521 - (43%) Gaps:106/521 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PLIGAMQLMLRLNPKTFIKVGREY-----VLKFGHL----QRVWIFNRLLIMSGD-AELNEQLLS 92
            |::|.:       |...:::.|.|     ||:..::    :..|.....::.:.| |.::..:.|
plant    45 PVLGML-------PGVLLRLQRIYDCSVEVLENSNMTFQFKGPWFVGMDVLATVDPANIHHIMSS 102

  Fly    93 SQEHLVKHPVYKVLGQWLGNGLLLSDGKVW------------HQR-RKIITPTFHFSILEQFVEV 144
            :..:.:|.|::..:.:..|:|::.:|.::|            ||| :.....|....:.:..|.:
plant   103 NFSNYIKGPIFHEIFEAFGDGIINTDAELWRDWRNASQLIFNHQRYQNFSASTTKTKVNDGLVPL 167

  Fly   145 FDQQSNICVQRLAQKANGNTFDVYRSICAAALDIIAETAMGTKIYAQANE--STPYAEAVNECTA 207
            |:..:|       ::...:..||::..   ..||......||...:.:.|  ...:::|:::...
plant   168 FNHFAN-------EEIVVDLEDVFQRF---MYDITFIFITGTDPRSLSIEMPEVEFSKALDDVGD 222

  Fly   208 LLSWRFMSVYLQVELLFTLTHPHLKWRQTQLIRTMQEFTIKVIEKRRQALEDQQSKLMDTADEDV 272
            .:..|.::             |...|:..:.|....|   |.:.|.....:....|::....|::
plant   223 AIVHRHIT-------------PRFVWKLQKWIGIGTE---KKMLKAHATFDRVCEKIIAAKREEL 271

  Fly   273 GSK--------RRMALLDVLLMSTVDG------RPLTNDEIREEVDTFMFEGHDTTTSALSFCLH 323
            ||:        .|..||...:  .:|.      :|..:..:|:....||..|.|:|.|.|::...
plant   272 GSQGITYNSNGEREDLLTSFI--KLDATKYEVLKPSHDKFLRDFTIGFMAAGRDSTASTLTWFFW 334

  Fly   324 ELSRHPEVQAKMLEEIVQVLGTDRSRPVSIRD----LGELKYMECVIKESLRMYPPVPIVGRKLQ 384
            .||::|.|..|:|:||    .|:..|..|.:|    |.:|.|:...:.||:|:|||:|       
plant   335 NLSKNPNVLTKILQEI----NTNLPRTGSDQDMSSYLNKLVYLHGALSESMRLYPPIP------- 388

  Fly   385 TDFKYTHSVHGDGVIPAGSE------IIIGIFGVHRQPETFPNPD--EFIPER---HENGSRVAP 438
              |:....:..| |:|:|.:      |:|.|:.:.|. :|....|  ||.|||   ...|.|..|
plant   389 --FQRKSPIKED-VLPSGHKVKSNINIMIFIYAMGRM-KTIWGEDAMEFKPERWISETGGVRHEP 449

  Fly   439 -FKMIPFSAGPRNCIGQKFAQLEMKMMLAKIVREYEL-LPMGQRVECIVNIVLRSETGFQLGMRK 501
             :|.:.|:||||.|:|:..|...||.::.:|::.||: :..||::|....::|..:.|.::.|.|
plant   450 SYKFLSFNAGPRTCLGKNLAMNLMKTVIVEILQNYEIKIVSGQKIEPKPGLILHMKHGLKVTMTK 514

  Fly   502 R 502
            :
plant   515 K 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 109/481 (23%)
CYP96A8NP_175193.1 p450 1..515 CDD:386267 117/519 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.