DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d8 and CYP72C1

DIOPT Version :9

Sequence 1:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:274 Identity:55/274 - (20%)
Similarity:109/274 - (39%) Gaps:53/274 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GAGWIIHLG---QADRRRKVA-NLPGPICPPLIGAMQLMLRLNPKTFIKVGREYVLKFGHLQRVW 72
            |..:.|.:|   ::::..:|| :||.|:....:..|...|.   .|.:|.|::....:|.     
plant    48 GNSYRILMGDMRESNQMDQVAHSLPLPLDADFLPRMMPFLH---HTVLKHGKKCFTWYGP----- 104

  Fly    73 IFNRLLIMSGDAELNEQLLSSQEHLVKHPVYKVLGQWLGNGLLLSDGKVWHQRRKIITPTFHFSI 137
             :..:::|  |.|...:::|..|...|..:......:| :|||..:|..|.:.|.|:.|.|....
plant   105 -YPNVIVM--DPETLREIMSKHELFPKPKIGSHNHVFL-SGLLNHEGPKWSKHRSILNPAFRIDN 165

  Fly   138 LEQFVEVFDQQSNICV---QRLAQKANGNTFDVYRSICAAALDIIAETAM------GTKIYAQAN 193
            |:..:..|:......:   :|||........|.:........:::|..:.      |.||:....
plant   166 LKSILPAFNSSCKEMLEEWERLASAKGTMELDSWTHCHDLTRNMLARASFGDSYKDGIKIFEIQQ 230

  Fly   194 ESTPYAEAVNECTALLSWRFMSVYLQVELLFTLTHPHLKWRQTQLIRTMQEFTIKVIEKRRQALE 258
            |...        ..||:.|  :||:          |..|:..|:..|.::|     .|:..:|: 
plant   231 EQID--------LGLLAIR--AVYI----------PGSKFLPTKFNRRLRE-----TERDMRAM- 269

  Fly   259 DQQSKLMDTADEDV 272
              ...:::|.:|::
plant   270 --FKAMIETKEEEI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 42/216 (19%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.