DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d8 and CYP709B3

DIOPT Version :9

Sequence 1:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_194501.1 Gene:CYP709B3 / 828885 AraportID:AT4G27710 Length:518 Species:Arabidopsis thaliana


Alignment Length:528 Identity:138/528 - (26%)
Similarity:224/528 - (42%) Gaps:106/528 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLFLLVVLLFGAGWIIHLG--QADRRRKVANLPGPICPPLIGAMQLMLRLN------------- 50
            :||..:|..::.|.||:.|.  ...:|.|...:.||....|.|.:..:.::.             
plant    13 VLLLFVVSKIWKACWILLLRPLMLSKRFKKQGISGPKYKILYGNLSEIKKMKKEADLCVLDPNSN 77

  Fly    51 ---PKTFIKVGREYVLKFGHLQRVWIFNRLLIMSGDAELNEQLLSSQEHL----VKHPVYKVLGQ 108
               |:.|.:. .:::.::|.....|...:..|...:.||.:|:|||:...    ||.|...:|  
plant    78 DIFPRVFPQY-HQWMSQYGDTFLFWTGTKPTIYISNHELAKQVLSSKFGFTIIPVKRPEVFIL-- 139

  Fly   109 WLGNGLLLSDGKVWHQRRKIITPTFHFSILEQFVEVFDQQSNICVQRL-----AQKANGNT---F 165
             .|.||....|..|.:.|:|:.|.|....|    :...|....|..|:     .|:.||..   .
plant   140 -FGKGLSFIQGDDWIRHRRILNPAFSMDRL----KAMTQPMGDCTLRIFEEWRKQRRNGEVLIKI 199

  Fly   166 DVYRSICAAALDIIAETAMGTKIYAQANESTPYAEAVNECTALLSWRFMSVYLQVEL----LFTL 226
            ::.:.......||||.||.|:.          |||.:..|.:           |.||    :.:|
plant   200 EISKEFHKLTADIIATTAFGSS----------YAEGIELCRS-----------QTELEKYYISSL 243

  Fly   227 TH---PHLKWRQT-------QLIRTMQEFTIKVIEKRRQALEDQQSKLMDTADEDVGSKRRMALL 281
            |:   |..::..|       :|.:.::....::|:.|.::    :.|.....|:         ||
plant   244 TNVFIPGTQYLPTPTNLKLWELHKKVKNSIKRIIDSRLKS----KCKTYGYGDD---------LL 295

  Fly   282 DVLLMSTVDG---RPLTNDEIREEVDTFMFEGHDTTTSALSFCLHELSRHPEVQAKMLEEIVQVL 343
            .|:|.:....   |.:..|||.||...|.:.|..||:..|::....||.|...|.|:.||:....
plant   296 GVMLTAAKSNEYERKMRMDEIIEECKNFYYAGQGTTSILLTWTTMLLSLHQGWQEKLREEVFNEC 360

  Fly   344 GTDRSRPVSIRD---LGELKYMECVIKESLRMYPPVPIVGRKLQTDFKYTHSVHGDGVIPAGSEI 405
            |.|:     |.|   ..:||.|..|:.||||:|.||..:.|:...|.|..|.     .||.|:.|
plant   361 GKDK-----IPDTDTFSKLKLMNMVLMESLRLYGPVIKISREATQDMKVGHL-----EIPKGTSI 415

  Fly   406 IIGIFGVHRQPETF-PNPDEFIPERHENG---SRVAPFKMIPFSAGPRNCIGQKFAQLEMKMMLA 466
            ||.:..:||....: .:.::|.|.|.|||   :.:.|..::|||.|||.||.:.||.:|.|.:|.
plant   416 IIPLLKMHRDKAIWGEDAEQFNPLRFENGISQATIHPNALLPFSIGPRACIAKNFAMVEAKTVLT 480

  Fly   467 KIVREYEL 474
            .|:::::|
plant   481 MILQQFQL 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 123/445 (28%)
CYP709B3NP_194501.1 p450 9..517 CDD:299894 138/528 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.