DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d8 and CYP702A6

DIOPT Version :9

Sequence 1:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_680696.2 Gene:CYP702A6 / 827207 AraportID:AT4G15396 Length:475 Species:Arabidopsis thaliana


Alignment Length:511 Identity:112/511 - (21%)
Similarity:200/511 - (39%) Gaps:136/511 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PGPICPPLIG----------AMQLMLRLNPKTFIKVGREYVLKFGHLQRVWIFNRLLIMSGDAEL 86
            ||.:..|:||          |:||      .||:|   |.||:.|.:.|..:|...:|:|.|..|
plant    37 PGSMGYPIIGETFEFMKPHDAIQL------PTFVK---EKVLRHGPVFRTSLFGGKVIISTDIGL 92

  Fly    87 NEQLLSSQEHLVKHPVYKVLGQWLG-NGLLLSDGKVWHQRRKIITPTFHFSILEQF-------VE 143
            |.: ::...|:...|  |.|.:..| |.|.::.....|.|          |:..||       :.
plant    93 NME-IAKTNHIPGMP--KSLARLFGANNLFVNKDTHKHAR----------SLTNQFLGSQALKLR 144

  Fly   144 VFDQQSNICVQRLAQKANGNTFDVYRSICAAALDIIAETAMGTKIYAQANESTPYAEAVNECTAL 208
            :......:....|.:.|...:.|:..:.....::.:|:..||        |..|  :|..|.|  
plant   145 MLQDIDFLVRTHLKEGARKGSLDIKETTSKIIIECLAKKVMG--------EMEP--DAAKELT-- 197

  Fly   209 LSWRFM--------------SVYLQVELLFTLTHPHLKWRQTQLIRTMQEFTIKVIEKRRQALED 259
            |.|.|.              .||..|:            .:.::::.::|   .|::||      
plant   198 LCWTFFPREWFGFAWNIPGTGVYRMVK------------ARNRMMKVLKE---TVLKKR------ 241

  Fly   260 QQSKLMDTADEDVGSKRRMALLDVLLMSTVDG------RPLTNDEIREEVDTFMFEGHDTTTSAL 318
                   .:.|::|.          ...|:.|      :.::.:...|.:.|.....::||.:.|
plant   242 -------ASGEELGD----------FFKTIFGDTERGVKTISLESATEYIFTLFLLANETTPAVL 289

  Fly   319 SFCLHELSRHPEVQAKMLEE----IVQVLGTDRSRPVSIRDLGELKYMECVIKESLRMYPPVPIV 379
            :..:..:|.||:|..::..|    :...:..:....::..|...:.:.:.||.||||:...||.|
plant   290 AATIKLISDHPKVMQELQREHEGIVRDKIEKNEKADLTWEDYKSMTFTQMVINESLRITSTVPTV 354

  Fly   380 GRKLQTDFKYTHSVHGDGVIPAGSEIIIGIFGVHRQPETFPNPDEFIPERHENG--SRVAPFKMI 442
            .|.:..:|::     |:..|||| .|.:|...||...|.:.:|..|.|.|.:..  |.:.....|
plant   355 LRIIDHEFQF-----GEYTIPAG-WIFMGYPYVHFNAEKYDDPLAFNPWRWKGKDLSAIVSRTYI 413

  Fly   443 PFSAGPRNCIGQKFAQLEMKMML-------------AKIVREYEL-LPMGQRVECI 484
            ||.:|.|.|:|.:|.:|:|.:.:             ..::|.:.| ||.|..|:.:
plant   414 PFGSGSRLCVGAEFVKLKMAIFIHHLSRYRWSMKTETTLLRRFVLILPRGSDVQIL 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 98/467 (21%)
CYP702A6NP_680696.2 p450 9..454 CDD:299894 106/494 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.