DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d8 and CYP702A5

DIOPT Version :9

Sequence 1:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001078393.1 Gene:CYP702A5 / 827206 AraportID:AT4G15393 Length:467 Species:Arabidopsis thaliana


Alignment Length:523 Identity:123/523 - (23%)
Similarity:216/523 - (41%) Gaps:108/523 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLFLLVVLLFGAGWIIHLGQADRRRKVANLPGPICPPLIGA----MQLMLRLNPKTFIKVGREY 61
            :::.|:||.|  ..||..........|:.  ||.:..|:||.    |:|...:...||:|   |.
plant    10 VIVSLIVVKL--CHWIYQWKNPKGNGKLP--PGSMGYPIIGETFEFMKLHDAIQLPTFVK---EK 67

  Fly    62 VLKFGHLQRVWIFNRLLIMSGDAELNEQLLSSQEHLVKHPVYKVLGQWLGNGLLLSDGKVWHQRR 126
            :|:.|.:.|..:|...:|:|.|..||.: ::...|:...|  |.|.:..|...|..: |..|:..
plant    68 LLRHGPVFRTSLFGGKVIISTDIGLNME-IAKTNHIPGMP--KSLERLFGATNLFVN-KDTHKHA 128

  Fly   127 KIITPTFHFS--ILEQFVEVFDQQSNICVQRLAQKANGNTFDVYRSICAAALDIIAETAMGTKIY 189
            :.:|..|..|  :..:.::..|..:...::..|:|   ...||..:.....::.:::..||    
plant   129 RSLTNQFLGSQALKLRMIQDIDFLARTHMKEGARK---GCLDVKETASKIVIECLSKKVMG---- 186

  Fly   190 AQANESTPYAEAVNECTALLSWRFM--------------SVYLQVELLFTLTHPHLKWRQTQLIR 240
                |..|  ||..|.|  |.|.|.              .||..|:            .:.::::
plant   187 ----EMEP--EAAKELT--LCWTFFPRDWFRFAWNFPGTGVYRIVK------------ARNRMMK 231

  Fly   241 TMQEFTIKVIEKRRQALEDQQSKLMDTADEDVGSKRRMALLDVLLMSTVDGRPLTNDEIREE-VD 304
            .::|..:|     ::|...:..:..:|...|..|         :.||.         ||..| :.
plant   232 VIKETVVK-----KRASGKKLGEFFETIFGDTES---------VTMSI---------EIATEYIF 273

  Fly   305 TFMFEGHDTTTSALSFCLHELSRHPEVQAKMLEE---IVQ-VLGTDRSRPVSIRDLGELKYMECV 365
            |.....::||...|:..:..:|.:|:|..::..|   ||| .:..|.:..::..|...:.:.:.|
plant   274 TLFVLANETTPGVLAATIKLISDNPKVMQELRREHEGIVQDKIKKDETADLTWEDYKSMTFTQMV 338

  Fly   366 IKESLRMYPPVPIVGRKLQTDFKYTHSVHGDGVIPAGSEIIIGIFGVHRQPETFPNPDEFIPERH 430
            |.||||:...||.|.|.:..:.::     ||..|||| .|.:|...||..||.:.:|..|.|.|.
plant   339 INESLRITSTVPTVLRIIDHEIQF-----GDYTIPAG-WIFMGYPYVHFNPEKYDDPLAFNPWRW 397

  Fly   431 ENG--SRVAPFKMIPFSAGPRNCIGQKFAQLEMKMML-------------AKIVREYEL-LPMGQ 479
            :..  |.:.....:||.:|.|.|:|.:|.:|:|.:.:             ..::|.:.| ||.|.
plant   398 KGKDLSTIVSKTYLPFGSGTRLCVGAEFVKLQMAIFIHHLFRYRWSMKAETTLLRRFILVLPRGS 462

  Fly   480 RVE 482
            .|:
plant   463 DVQ 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 104/454 (23%)
CYP702A5NP_001078393.1 p450 30..448 CDD:386267 111/482 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.