DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d8 and CYP702A8

DIOPT Version :9

Sequence 1:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_189648.1 Gene:CYP702A8 / 822729 AraportID:AT3G30290 Length:408 Species:Arabidopsis thaliana


Alignment Length:454 Identity:111/454 - (24%)
Similarity:186/454 - (40%) Gaps:98/454 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 RVWIFNRLLIMSGDAELN-EQLLSSQEHLVKHPVYKVLGQWLGNGLLLSDGKVWHQRRKIITPTF 133
            |..:|...:|:|.|.||| |...:::...:...:.::.|:  .|.|.|...:. |:..:.:|   
plant     6 RTSLFGGKVIISMDNELNMEMAKTNRTPGITKSIARLFGE--DNNLFLQSTES-HKHVRNLT--- 64

  Fly   134 HFSILEQFVEVFDQQS-------NICV---QRLAQKANGNTFDVYRSICAAALDIIAETAMGTKI 188
                    |::...||       ||.:   ..:.:.|...:.||..:.....::.:|:..||   
plant    65 --------VQMLGSQSLKLRIMENIDLLTRTHMEEGARDGSLDVKETTSKILIECLAKKVMG--- 118

  Fly   189 YAQANESTPYAEAVNECTALLSWR-FMSVYLQVELLFTL----THPHLKWRQTQLIRTMQEFTIK 248
                 |..|  ||..:..  |.|| |.|.:.:  |.|.|    .:..:|.|     :.|:....:
plant   119 -----EMEP--EAAKKLA--LCWRYFPSGWFR--LPFNLPGIGVYNMMKAR-----KRMKTLLKE 167

  Fly   249 VIEKRRQALED--QQSKLMDTADEDVGSKRRMALLDVLLMSTVDGRPLTNDEIREEVDTFMFEGH 311
            .:.|:|:|.|:  :.||::  ..|..|.|..|::.:|:                |.:.||....:
plant   168 EVLKKREAGEEFGEFSKII--FGEKEGEKETMSMKNVI----------------EYIYTFFVIAN 214

  Fly   312 DTTTSALSFCLHELSRHPEVQAKMLEEIVQVLGTDRSRPVSI--RDLGELKYMECVIKESLRMYP 374
            :||...|:..:..:|.:|:|..::..|...:. .::|....:  .|...:.:...||.||||:..
plant   215 ETTPRILAATVKFISENPKVMQELQREHAMIF-ENKSEEAGLTWEDYKSMTFTNMVINESLRIST 278

  Fly   375 PVPIVGRKLQTDFKYTHSVHGDGVIPAGSEIIIGIFGVHRQPETFPNPDEFIPERHENG--SRVA 437
            .||::.||...|.|.     ||..||||.. .:|....|..|..:.:|.||.|.|.:..  ..:.
plant   279 TVPVILRKPDHDTKV-----GDYTIPAGWN-FMGYPSAHFDPTKYEDPLEFNPWRWKGNDLDAIV 337

  Fly   438 PFKMIPFSAGPRNCIGQKFAQLEMKMML-------------AKIVREYELL-PMGQRVECIVNI 487
            ....|||.||||.|:|..||:|.|.:.:             ..:.|.|.|: |.|    |.|.|
plant   338 STNYIPFGAGPRLCVGAYFAKLLMAIFIHHLCRYRWSMKAEVTVTRSYMLMFPRG----CDVQI 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 111/454 (24%)
CYP702A8NP_189648.1 p450 5..374 CDD:299894 103/425 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.