DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d8 and CYP94C1

DIOPT Version :9

Sequence 1:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_180337.1 Gene:CYP94C1 / 817315 AraportID:AT2G27690 Length:495 Species:Arabidopsis thaliana


Alignment Length:491 Identity:115/491 - (23%)
Similarity:199/491 - (40%) Gaps:151/491 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 MLRLNPKTFIKVGREYVLKFGHLQRVWIFNRLLIMSGDAELNEQLLSSQEHLVK-----HPVYK- 104
            :||.:|.:.|||         |     :.|.::..:.         |:.||::|     :|..| 
plant    59 LLRRSPTSTIKV---------H-----VLNSVITANP---------SNVEHILKTNFHNYPKGKQ 100

  Fly   105 ---VLGQWLGNGLLLSDGKVWHQRRKIIT--------PTFHFSILEQFVE--------------- 143
               :||..||.|:..|||..|..:||:.:        ..|...|::..:|               
plant   101 FSVILGDLLGRGIFNSDGDTWRFQRKLASLELGSVSVRVFAHEIVKTEIETRLLPILTSFSDNPG 165

  Fly   144 -VFDQQSNICVQRLAQKANGNTFDVYRSICAAALDIIAETAMG-----TKIYAQANESTPYAEAV 202
             |.|.|                 ||:|..   :.|.|::.:.|     .::....:|   :|.|.
plant   166 SVLDLQ-----------------DVFRRF---SFDTISKLSFGFDPDCLRLPFPISE---FAVAF 207

  Fly   203 NECTALLSWRFMSVYLQVELLFTLTHPHLKWRQTQLIRTMQEFTIK------------VIEKRR- 254
            :..:.|.:.|.::.:            .|.|:..:|:|...|..::            :|::|| 
plant   208 DTASLLSAKRALAPF------------PLLWKTKRLLRIGSEKKLQESINVINRLAGDLIKQRRL 260

  Fly   255 ---QALEDQQSKLMDTADEDVGSKRRMALLDVLLMSTVDGRPLTNDE-IREEVDTFMFEGHDTTT 315
               ....|..|:.|....||                        :|| :|:.|.:|:..|.||..
plant   261 TGLMGKNDLISRFMAVVAED------------------------DDEYLRDIVVSFLLAGRDTVA 301

  Fly   316 SALSFCLHELSRHPEVQAKMLEEIVQVLGTDRSRPVSIR--DLGELKYMECVIKESLRMYPPVPI 378
            :.|:.....|:|||||:.::.||:.:|:||... .|:.|  ::.|:.|:...:.||:|::|||  
plant   302 AGLTGFFWLLTRHPEVENRIREELDRVMGTGFD-SVTARCDEMREMDYLHASLYESMRLFPPV-- 363

  Fly   379 VGRKLQTDFKYTHSVHGDGV-IPAGSEIIIGIFGVHRQPETF-PNPDEFIPER---HENGSRVA- 437
               :..:.|.....|..||. :.:|:.:....:.:.|....: |:.:||.|||   :|...|.. 
plant   364 ---QFDSKFALNDDVLSDGTFVNSGTRVTYHAYAMGRMDRIWGPDYEEFKPERWLDNEGKFRPEN 425

  Fly   438 PFKMIPFSAGPRNCIGQKFAQLEMKMMLAKIVREYE 473
            |.|...|.||.|.|||::.|.:|||.:...|:|.:|
plant   426 PVKYPVFQAGARVCIGKEMAIMEMKSIAVAIIRRFE 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 109/471 (23%)
CYP94C1NP_180337.1 PLN02426 23..495 CDD:215235 115/491 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.