DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d8 and TBXAS1

DIOPT Version :9

Sequence 1:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001159725.2 Gene:TBXAS1 / 6916 HGNCID:11609 Length:579 Species:Homo sapiens


Alignment Length:532 Identity:131/532 - (24%)
Similarity:210/532 - (39%) Gaps:132/532 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DRRRKVANLPGPICPPLIGAMQLMLRLNPKTFIKVGREYVLKFGH------------------LQ 69
            :.:.::..|.||:|...:|....::...|....:|..|....|.:                  ..
Human    65 ESQMELRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSVLFLRD 129

  Fly    70 RVWIFNRLLIMS--GDAELNE-QLLSSQEHLVKHPVYKVLGQWLGNGLLLSDGKVWHQRRKIITP 131
            :.|...|..:||  ...:||| .||..||.:..|         :|       |:...||   |.|
Human   130 KRWEEVRGALMSAFSPEKLNELGLLIMQERIKGH---------MG-------GQQAPQR---IPP 175

  Fly   132 T-----------FHFSILE-QFVEVFDQQSNICVQRLAQKA-NGNTFDVYRSICAAALDIIAETA 183
            |           .|::.|. ..|.:..|..::.:..|.:.| :|:.||:.|..|....|::|..|
Human   176 TRLSKPSGIYVNLHYATLPFCMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVA 240

  Fly   184 MGTKIYAQANESTPYAEAVNECTALLSWRFMSVYL-QVELLFTLTHPHLKWRQTQLIRTMQEFTI 247
            .||.:.:......|:   |..|.     ||....: :..|:..|:.|.:   ...|.|.:.    
Human   241 FGTPVDSWQAPEDPF---VKHCK-----RFFEFCIPRPILVLLLSFPSI---MVPLARILP---- 290

  Fly   248 KVIEKRRQALEDQQSKLMDTA----DEDVGSKRRMALLDVLL--------MSTVD---------- 290
               .|.|..|....:||:...    |:....:||...|.::|        |...|          
Human   291 ---NKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDIVRDVFSS 352

  Fly   291 ----------------GRPLTNDEIREEVDTFMFEGHDTTTSALSFCLHELSRHPEVQAKMLEEI 339
                            .||||.|||..:...|:..|::..|:.|||..:.|:.:|:.|.|:|.| 
Human   353 TGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNTLSFATYLLATNPDCQEKLLRE- 416

  Fly   340 VQVLGTDRSRP--VSIRDLGELKYMECVIKESLRMYPPVPIVGRKLQTDFKYTHSVHGD-----G 397
            |.|.......|  .|:.:  .|.|::.||.|:||||||.          |::|.....|     .
Human   417 VDVFKEKHMAPEFCSLEE--GLPYLDMVIAETLRMYPPA----------FRFTREAAQDCEVLGQ 469

  Fly   398 VIPAGSEIIIGIFGVHRQPETFPNPDEFIPERH--ENGSRVAPFKMIPFSAGPRNCIGQKFAQLE 460
            .||||:.:.:.:..:|..||.:|:|:.|.|||.  |...:..||..:||.||||:|:|.:...||
Human   470 RIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLLE 534

  Fly   461 MKMMLAKIVREY 472
            :|:.|..::.::
Human   535 VKLTLLHVLHKF 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 122/489 (25%)
TBXAS1NP_001159725.2 p450 47..576 CDD:306555 131/532 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2429
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.