DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d8 and Cyp3a71-ps

DIOPT Version :9

Sequence 1:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster
Sequence 2:XP_008767252.2 Gene:Cyp3a71-ps / 690383 RGDID:1597309 Length:183 Species:Rattus norvegicus


Alignment Length:119 Identity:27/119 - (22%)
Similarity:47/119 - (39%) Gaps:25/119 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LLSDGKVWHQRRKIITPTFHFSILEQFVEVFDQQSNICVQRLAQKA-NGNTFDVYRSICAAALDI 178
            :.:.||:     |::.|            :.....:|.|:.|.|:| .|....|.....|.::|:
  Rat     1 MFTSGKL-----KVMFP------------IIKLYGDILVKYLRQEAEKGKPVSVKDIFGAYSMDV 48

  Fly   179 IAETAMGTKIYAQANESTPYAEAVNECTALLSWRFMSVYLQVELLFTLTHPHLK 232
            |..|:.|..:.:..|...|:.|...:...|  ..|..:::.|||.     |.||
  Rat    49 ITSTSFGVNVDSLNNPKDPFVEKTKKFLRL--DYFDPLFISVELF-----PFLK 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 27/119 (23%)
Cyp3a71-psXP_008767252.2 cytochrome_P450 2..>153 CDD:425388 27/118 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.