DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d8 and cyp4f2

DIOPT Version :9

Sequence 1:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001016020.1 Gene:cyp4f2 / 548774 XenbaseID:XB-GENE-6258041 Length:528 Species:Xenopus tropicalis


Alignment Length:415 Identity:150/415 - (36%)
Similarity:235/415 - (56%) Gaps:33/415 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 YKVLGQWLGNGLLLSDGKVWHQRRKIITPTFHFSILEQFVEVFDQQSNICV---QRLAQKANGN- 163
            |..|..|||:|||||.|:.|.|.|:::||.|||.||:.:|::|:|.::|.:   :||.  |.|. 
 Frog   132 YGFLRPWLGDGLLLSRGEKWGQHRRLLTPAFHFDILKNYVKIFNQSTDIMLAKWRRLT--AEGPV 194

  Fly   164 TFDVYRSICAAALDIIAETAMGTKIYAQANESTPYAEAVNECTALLSWRFMSVYLQVELLFTLTH 228
            :.|::..:....||.:.:.........|...| .|..|:.|.::|:..|...:....:.::.|:.
 Frog   195 SLDMFEHVSLMTLDTLLKCTFSYDSDCQEKPS-DYISAIYELSSLVVKREHYLPHHFDFIYNLSS 258

  Fly   229 PHLKWRQTQLIRTMQEFTIKVIEKRRQALEDQ------QSKLMDTADEDVGSKRRMALLDVLLMS 287
            ...|:||.  .:|:.|||..|:::|::||:::      :||...|.|          .:|:||:|
 Frog   259 NGRKFRQA--CKTVHEFTAGVVQQRKKALQEKGMEEWIKSKQGKTKD----------FIDILLLS 311

  Fly   288 -TVDGRPLTNDEIREEVDTFMFEGHDTTTSALSFCLHELSRHPEVQAKMLEEIVQVLGTDRSRPV 351
             ..||..|:::::|.|||||||||||||.|.||:.|:.|:.|||.|.|..:||.::|.....:.:
 Frog   312 KNEDGSQLSDEDMRAEVDTFMFEGHDTTASGLSWILYNLACHPEYQEKCRKEITELLEGKDIKHL 376

  Fly   352 SIRDLGELKYMECVIKESLRMYPPVPIVGRKLQTDFKYTHSVHGDGVIPAGSEIIIGIFGVHRQP 416
            ...:|.:|.:....||||||::|||..|.|:...|.|..   .|| ::|.|:..||.|||:|..|
 Frog   377 EWDELSKLPFTTMCIKESLRLHPPVVAVIRRCTEDIKLP---KGD-ILPKGNCCIINIFGIHHNP 437

  Fly   417 ETFPNPDEFIPERH--ENGSRVAPFKMIPFSAGPRNCIGQKFAQLEMKMMLAKIVREYEL-LPMG 478
            :.:|||..:.|.|.  ||....:.:..:||||||||||||.||..|||::||.|:..::: |...
 Frog   438 DVWPNPQVYDPYRFDPENLQERSSYAFVPFSAGPRNCIGQNFAMAEMKIVLALILYNFQVRLDET 502

  Fly   479 QRVECIVNIVLRSETGFQLGMRKRK 503
            :.|.....::||:|.|..|.:.:.|
 Frog   503 KTVRRKPELILRAENGLWLQVEELK 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 148/407 (36%)
cyp4f2NP_001016020.1 p450 60..513 CDD:278495 144/399 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.