DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d8 and sad

DIOPT Version :9

Sequence 1:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster


Alignment Length:541 Identity:114/541 - (21%)
Similarity:194/541 - (35%) Gaps:138/541 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VVLLFGAGWIIHLGQ-ADRRRKVANLPGPICPPLIGAMQLMLRLNPKTFIKVGREYVLKFGH--- 67
            :|.|..||...||.: .|.|.|..   |||....:|..|      ...|:.........|.|   
  Fly    71 LVDLIAAGGATHLHKYIDARHKQY---GPIFRERLGGTQ------DAVFVSSANLMRGVFQHEGQ 126

  Fly    68 -----LQRVWIFNRLLIMSGDAELNEQLLSSQEHLVKHPVYKVLGQWLGNGLLLSDGKVWHQRRK 127
                 |...|                 .|.:|:|..:            .||...:|..|...|:
  Fly   127 YPQHPLPDAW-----------------TLYNQQHACQ------------RGLFFMEGAEWLHNRR 162

  Fly   128 IITPTFHFSILEQFVEVFDQQSNICVQRLAQKANGNTFDVYRSICAAALDIIAETAMGTKIYAQA 192
            |:...    :|...:...|.....|.:|:..:....|.:      |||:.:           |::
  Fly   163 ILNRL----LLNGNLNWMDVHIESCTRRMVDQWKRRTAE------AAAIPL-----------AES 206

  Fly   193 NESTPYAEAVNECTALLSWRFMSVYLQVELLF---TLTHPHLKW--------------------- 233
            .|...|...:.| ..|..|   |:.:...::|   .||.|.::.                     
  Fly   207 GEIRSYELPLLE-QQLYRW---SIEVLCCIMFGTSVLTCPKIQSSLDYFTQIVHKVFEHSSRLMT 267

  Fly   234 ---RQTQLIR--TMQEFTIKVIEKRRQALEDQQSKLMD---TADEDVGSKRRMALLDVLLMSTVD 290
               |..|::|  ..::|...|.|..|:.     :.::|   ...||.......||...|..:.|.
  Fly   268 FPPRLAQILRLPIWRDFEANVDEVLREG-----AAIIDHCIRVQEDQRRPHDEALYHRLQAADVP 327

  Fly   291 GRPLTNDEIREEVDTFMFEGHDTTTSALSFCLHELSRHPEVQAKMLEEIVQVLGTDRSRPVSIRD 355
            |     |.|:......:....|||..:..:.|..||:.|.:|.::.:|               |.
  Fly   328 G-----DMIKRIFVDLVIAAGDTTAFSSQWALFALSKEPRLQQRLAKE---------------RA 372

  Fly   356 LGELKYMECVIKESLRMYPPVPIVGRKLQTDFKYTHSVHGDGVIPAGSEIIIGIFGVHRQPETFP 420
            ..:.:.|..:||||||:||..|.:||.|..|.:.     |...|...:.:::.::...|.|..|.
  Fly   373 TNDSRLMHGLIKESLRLYPVAPFIGRYLPQDAQL-----GGHFIEKDTMVLLSLYTAGRDPSHFE 432

  Fly   421 NPDEFIPERHENGSRVAPFK---MIPFSAGPRNCIGQKFAQLEMKMMLAKIVREYELLPMGQR-V 481
            .|:..:|||...|......|   .:||:.|.|:|||::.|..::..:|.:...::|:..:.:. |
  Fly   433 QPERVLPERWCIGETEQVHKSHGSLPFAIGQRSCIGRRVALKQLHSLLGRCAAQFEMSCLNEMPV 497

  Fly   482 ECIVNIVLRSETGFQLGMRKR 502
            :.::.:|...:...:|.:|.|
  Fly   498 DSVLRMVTVPDRTLRLALRPR 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 95/474 (20%)
sadNP_650123.1 p450 63..497 CDD:299894 109/518 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.