DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d8 and Cyp6w1

DIOPT Version :9

Sequence 1:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001286145.1 Gene:Cyp6w1 / 35543 FlyBaseID:FBgn0033065 Length:514 Species:Drosophila melanogaster


Alignment Length:508 Identity:116/508 - (22%)
Similarity:208/508 - (40%) Gaps:94/508 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PLIGAMQLMLRLNPKTFIKVGREYVLKFGH--------LQRVWIFNRLLIMSGDAEL-------- 86
            |::|..:..|......|     |.:.||..        ...|::.:|..::..|.||        
  Fly    37 PVVGCTREFLTAKVPFF-----EQIQKFHEAPGFENEPFVGVYMTHRPALVIRDLELIKTVMIKK 96

  Fly    87 ----NEQLLSSQEHLVKHPVYKVLGQWLGNGLLLSDGKVWHQRRKIITPTFHFSILEQFVEVFDQ 147
                |.::|.:..|      ...||.   ..|..:....|.:.|..|:|.|....::|...:..:
  Fly    97 FQYFNNRVLQTDPH------NDALGY---KNLFFARSPGWRELRTKISPVFTSGKIKQMYPLMVK 152

  Fly   148 -QSNICVQRLAQKANGNTFDVYRSICAA-ALDIIAETAMGTKIYAQANESTPY---AEAVNECTA 207
             ..|:  |..|::....|....:.:|:. ..|:||..|.|.:..|..:..:.:   ..|:...|.
  Fly   153 IGKNL--QDSAERLGSGTEVQVKDLCSRFTTDLIATIAFGVEANALQDAKSEFFYHNRAIFSLTL 215

  Fly   208 LLSWRFMSVYLQVELLFTLTHPHLKWRQ-TQLIRTMQEFTIKVIEKRRQALEDQQSKLMDTADED 271
            .....|..::: :..|.:|....|..|: |:.||:...:.:|  |:.|                 
  Fly   216 SRGIDFAIIFM-IPALASLARVKLFSRETTKFIRSSVNYVLK--ERER----------------- 260

  Fly   272 VGSKRRMALLDVLLMSTVDGRPLTN-DEIREEVD---------TFMFEGHDTTTSALSFCLHELS 326
            .|.||. .|:|:||  .:......| .::.:|||         .|...|.:|:.|.::..|:||:
  Fly   261 TGEKRN-DLIDILL--ALKREAAANPGKMSKEVDLDYLVAQAAVFQTAGFETSASTMTMTLYELA 322

  Fly   327 RHPEVQAKMLEEIVQVLGTDRSRPVSIRDLGELKYMECVIKESLRMYPPVPIVGRKLQTDF---K 388
            ::..:|.::.:|||...|.:..  :|...:.|:.|:..|:.|:||.||.|..:.|:.....   :
  Fly   323 KNEALQDRLRQEIVDFFGDEDH--ISYERIQEMPYLSQVVNETLRKYPIVGYIERECSQPAEGER 385

  Fly   389 YTHSVHGDGVIPAGSEIIIGIFGVHRQPETFPNPDEFIPERHENGSR--VAPFKMIPFSAGPRNC 451
            :|.....:..:|.|..|.:....|||.|:.:|:|:::.|||..:.:|  :.....:||..|||||
  Fly   386 FTLEPFHNMELPHGMSIYMSTVAVHRDPQYWPDPEKYDPERFNSSNRDNLNMDAYMPFGVGPRNC 450

  Fly   452 IGQKFAQLEMKMMLAKIVREY------------ELLPMGQRVECIVNIVLRSE 492
            ||.:...|:.|:.|..|:|.:            |..|....:....:|:||.|
  Fly   451 IGMRLGLLQSKLGLVHILRNHRFHTCDKTIKKIEWAPTSPVMASKRDIILRVE 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 109/480 (23%)
Cyp6w1NP_001286145.1 p450 34..501 CDD:278495 113/504 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2429
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.