DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d8 and Cyp4a3

DIOPT Version :9

Sequence 1:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster
Sequence 2:XP_038965516.1 Gene:Cyp4a3 / 298423 RGDID:631356 Length:511 Species:Rattus norvegicus


Alignment Length:410 Identity:133/410 - (32%)
Similarity:218/410 - (53%) Gaps:26/410 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 VYKVLGQWL----GNGLLLSDGKVWHQRRKIITPTFHFSILEQFVEVFDQQSNICVQRLAQ-KAN 161
            :|:.|..|:    |.||||.:||.|.|..:::||.||:.||:.:|::.....:|.:.:..: ...
  Rat   116 IYQFLAPWIVSGTGYGLLLLNGKKWFQHWRMLTPAFHYGILKPYVKIMADSVSIMLDKWEKLDDQ 180

  Fly   162 GNTFDVYRSICAAALDIIAETAMGTKIYAQAN-ESTPYAEAVNECTALLSWRFMSVYLQVELLFT 225
            .:..:::..:....||.:.:.|...:...|.: .|..|.:||.:...|..:|..|.:....:::.
  Rat   181 DHPLEIFHYVSLMTLDTVMKCAFSHQGSVQLDVNSRSYTKAVEDLNNLTFFRVRSAFYGNSIIYN 245

  Fly   226 LTHP-HLKWRQTQLIRTMQEFTIKVIEKRRQALEDQQSKLMDTADEDVGSKRRMALLDVLLMSTV 289
            ::.. .|..|..|:   ..|.|..||:.|:..|::::..      :....||.:..||:||.:.:
  Rat   246 MSSDGRLSRRACQI---AHEHTDGVIKMRKAQLQNEEEL------QKARKKRHLDFLDILLFAKM 301

  Fly   290 -DGRPLTNDEIREEVDTFMFEGHDTTTSALSFCLHELSRHPEVQAKMLEEIVQVLGTDRSRPVSI 353
             ||:.|:::::|.|||||||||||||.|.:|:..:.|:.|||.|.:..||:..:||...|  |:.
  Rat   302 EDGKSLSDEDLRAEVDTFMFEGHDTTASGISWVFYALATHPEHQERCREEVQSILGDGTS--VTW 364

  Fly   354 RDLGELKYMECVIKESLRMYPPVPIVGRKLQTDFKYTHSVHGDG-VIPAGSEIIIGIFGVHRQPE 417
            ..|.::.|....|||:||:|||||.|.|:|.:...:.     || .||.|....|.|:|:|..|.
  Rat   365 DHLDQISYTTMCIKEALRLYPPVPSVSRELSSPVTFP-----DGRSIPKGITTTILIYGLHHNPS 424

  Fly   418 TFPNPDEFIPERHENGSRVAPFKMIPFSAGPRNCIGQKFAQLEMKMMLAKIVREYELLPMGQRVE 482
            .:|||..|.|.|....|.......:|||.|.|||||::||..|:|:.:|..:..:||||...|:.
  Rat   425 YWPNPKVFDPSRFSPDSPRHSHAYLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLPDPTRIP 489

  Fly   483 C-IVNIVLRSETGFQLGMRK 501
            . :..:||:|:.|..|.::|
  Rat   490 VPMARLVLKSKNGIHLRLKK 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 131/404 (32%)
Cyp4a3XP_038965516.1 CYP4B-like 69..506 CDD:410771 131/405 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348464
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.