DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d8 and CYP4X1

DIOPT Version :9

Sequence 1:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_828847.1 Gene:CYP4X1 / 260293 HGNCID:20244 Length:509 Species:Homo sapiens


Alignment Length:503 Identity:141/503 - (28%)
Similarity:250/503 - (49%) Gaps:63/503 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LIGAMQLMLRLN-----------PKTFIKVGREYVLKFGHLQRV-------------WI--FNRL 77
            |:.|::|.||..           |.|...:|.:..::..:::::             ||  |...
Human    26 LLQAIKLYLRRQRLLRDLRPFPAPPTHWFLGHQKFIQDDNMEKLEEIIEKYPRAFPFWIGPFQAF 90

  Fly    78 LIMSGDAELNEQLLSSQEHLVKHPVYKVLGQWLGNGLLLSDGKVWHQRRKIITPTFHFSILEQFV 142
            ..:. |.:..:.|||..:...:: :.|.....||.||...||..|.|.|:::||.|||:||:.::
Human    91 FCIY-DPDYAKTLLSRTDPKSQY-LQKFSPPLLGKGLAALDGPKWFQHRRLLTPGFHFNILKAYI 153

  Fly   143 EV--------FDQQSNICVQRLAQKANGNTFDVYRSICAAALDIIAETAMGTKIYAQANES-TPY 198
            ||        .|:...||      .....:.:||..|.:.:||||.:.|...:...|.|.: .||
Human   154 EVMAHSVKMMLDKWEKIC------STQDTSVEVYEHINSMSLDIIMKCAFSKETNCQTNSTHDPY 212

  Fly   199 AEAVNECTALLSWRFMSVYLQVELLFTLTHPHLKWRQTQLIRTMQEFTIKVIEKRRQALEDQQSK 263
            |:|:.|.:.::..|..|:....:::|.|: |. .:|..:|.|.:.::|..:|::|:::|:     
Human   213 AKAIFELSKIIFHRLYSLLYHSDIIFKLS-PQ-GYRFQKLSRVLNQYTDTIIQERKKSLQ----- 270

  Fly   264 LMDTADEDVGSKRRMALLDVLLMSTVD-GRPLTNDEIREEVDTFMFEGHDTTTSALSFCLHELSR 327
             .....::...::....||::|.:..: |...::.::..||.||:..||||..:::|:.|:.|:.
Human   271 -AGVKQDNTPKRKYQDFLDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLAL 334

  Fly   328 HPEVQAKMLEEIVQVLGTDRSRPVSIRDLGELKYMECVIKESLRMYPPVPIVGRKLQTDFKYTHS 392
            :||.|.:..||:..:||...|  ::...|||:.|....|||:.|:.|.||.:.|.|.....:.  
Human   335 NPEHQERCREEVRGILGDGSS--ITWDQLGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFP-- 395

  Fly   393 VHGDG-VIPAGSEIIIGIFGVHRQPETFPNPDEFIPER--HENGSRVAPFKMIPFSAGPRNCIGQ 454
               || .:|||..:::.|:|:|..|..:.||..|.|.|  .||..:..|:..:|||||.||||||
Human   396 ---DGCTLPAGITVVLSIWGLHHNPAVWKNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQ 457

  Fly   455 KFAQLEMKMMLAKIVREYELLPMGQRVECIVN-IVLRSETGFQLGMRK 501
            :||.:|:|:.:|.|:..:.:.|...|.....| .:|:.:.|..|.::|
Human   458 EFAMIELKVTIALILLHFRVTPDPTRPLTFPNHFILKPKNGMYLHLKK 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 131/459 (29%)
CYP4X1NP_828847.1 p450 47..501 CDD:306555 134/476 (28%)
heme binding region 447..460 10/12 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154706
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.