DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d8 and CYP4Z1

DIOPT Version :9

Sequence 1:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_835235.1 Gene:CYP4Z1 / 199974 HGNCID:20583 Length:505 Species:Homo sapiens


Alignment Length:515 Identity:145/515 - (28%)
Similarity:253/515 - (49%) Gaps:49/515 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLFLLVVLLFGAGWIIHLGQADRRRKVANLPGPICPPLIGAMQLMLRLNPKTFIKVGREYVLKF 65
            :|||.::.|.....|:|        |.:...|.|......|..:..    |....:|..:.:.|:
Human    24 LLLFQVIRLYQRRRWMI--------RALHLFPAPPAHWFYGHKEFY----PVKEFEVYHKLMEKY 76

  Fly    66 GHLQRVWIFNRLLIMS-GDAELNEQLLSSQE--HLVKHPVYKVLGQWLGNGLLLSDGKVWHQRRK 127
            .....:|:....:..| .|.:..:.||..|:  ..|.|   |:|..|:|.||:..||..|.:.|:
Human    77 PCAVPLWVGPFTMFFSVHDPDYAKILLKRQDPKSAVSH---KILESWVGRGLVTLDGSKWKKHRQ 138

  Fly   128 IITPTFHFSILEQFVEVFDQQSNICVQRLAQK-ANGNTFDVYRSICAAALDIIAETAMGTKIYAQ 191
            |:.|.|:.|||:.|:.:..:...:.:.:..:. |..:..::::.:....||.|.:.|...:...|
Human   139 IVKPGFNISILKIFITMMSESVRMMLNKWEEHIAQNSRLELFQHVSLMTLDSIMKCAFSHQGSIQ 203

  Fly   192 ANES-TPYAEAVNECTALLSWRFMSVYLQVELLFTLTHPHLKWRQTQLI----RTMQEFTIKVIE 251
            .:.: ..|.:||...:.:.:.|..:.....:|:|..:      .|.|:.    :.:.:||.|||:
Human   204 LDSTLDSYLKAVFNLSKISNQRMNNFLHHNDLVFKFS------SQGQIFSKFNQELHQFTEKVIQ 262

  Fly   252 KRRQALEDQQSKLMDTADEDVGSKRRMALLDVLLMSTVDG-RPLTNDEIREEVDTFMFEGHDTTT 315
            .|:::|:|:       ..:|...|||...||:||.:..:. :..:..:::.||.||||.|||||:
Human   263 DRKESLKDK-------LKQDTTQKRRWDFLDILLSAKSENTKDFSEADLQAEVKTFMFAGHDTTS 320

  Fly   316 SALSFCLHELSRHPEVQAKMLEEIVQVLGTDRSRPVSIRDLGELKYMECVIKESLRMYPPVPIVG 380
            ||:|:.|:.|:::||.|.:..:||.::||...|  ::...|.::.|....|||.||:|.||..:.
Human   321 SAISWILYCLAKYPEHQQRCRDEIRELLGDGSS--ITWEHLSQMPYTTMCIKECLRLYAPVVNIS 383

  Fly   381 RKLQTDFKYTHSVHGDG-VIPAGSEIIIGIFGVHRQPETFPNPDEFIPER--HENGSRVAPFKMI 442
            |.|.....:.     || .:|||..:.|.|:.:|..|..:.:|..|.|.|  .||..::.|:..|
Human   384 RLLDKPITFP-----DGRSLPAGITVFINIWALHHNPYFWEDPQVFNPLRFSRENSEKIHPYAFI 443

  Fly   443 PFSAGPRNCIGQKFAQLEMKMMLAKIVREYELLPMGQR-VECIVNIVLRSETGFQLGMRK 501
            |||||.||||||.||.:|.|:.:|..:..::|.|...| .:.:..:||:|:.|..:..:|
Human   444 PFSAGLRNCIGQHFAIIECKVAVALTLLRFKLAPDHSRPPQPVRQVVLKSKNGIHVFAKK 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 131/444 (30%)
CYP4Z1NP_835235.1 p450 47..500 CDD:278495 137/479 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154707
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.